DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and stl

DIOPT Version :9

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:NP_001097423.1 Gene:stl / 37619 FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster


Alignment Length:433 Identity:90/433 - (20%)
Similarity:126/433 - (29%) Gaps:151/433 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GGPGQWSSWSDWSTCSRTC---------DG--GIMHQMRRC-GSPGSCRGESTRYRICNMQPC-- 123
            |.|..|..||:.|.|...|         :|  |:....|.| ..|..|.|...|:..||...|  
  Fly   678 GSPSNWGEWSEPSACESGCLYGQSRRLLEGSTGLRTLNRSCLNFPSRCIGRDRRFVTCNTPQCHK 742

  Fly   124 -PEQ--QDFRSSQC--SAYNDVPYDGTLYKWTPHYDYVEPCALTCRGHPAHLVEDISRETGDGNA 183
             |.|  .||.:..|  :..:|....|...:.....|  ..|.:.||...              |.
  Fly   743 VPVQTINDFATQVCMQARKSDPELTGEGQQLPSTLD--ASCKIFCRTRT--------------NG 791

  Fly   184 EEAEHYDEQSVIVQLSARVQDGTRCRS-----GSLDMCIQGKCQRVGCDLKIGSTKKIDGCGVCG 243
            .::..:           ...|||.|::     ..:..||.|:|:|..||                
  Fly   792 TKSRRW-----------TFPDGTTCKAKQHNPEDITYCISGRCERFSCD---------------- 829

  Fly   244 GDGNSCSQPLFNWEMAPMSQCSVTCGSGYKMSRPICRNRL---TNADVDDTLCSVTNRPEASVEQ 305
               ||.|                   :.:||....|..|.   |....|......|||...:..|
  Fly   830 ---NSTS-------------------NFFKMDSSFCEARSVRPTRDSSDQESRQQTNRQRYAERQ 872

  Fly   306 CNTHSCPPRWIADDWSTCSRLCGHG---------YRERMVVCAEESNGIKTRVADIMCRTPKPPT 361
               ...|.:...::........|.|         |:.|        |..|....:|  ..|.||.
  Fly   873 ---EGKPQKNHYENEVAKRPSYGQGNHINAPASPYKRR--------NYHKPYPPEI--PRPPPPA 924

  Fly   362 QETCIIEECPHWEVEDWT---GCSVSC---GQGIQMRGVECKSTDGSLSAKCDPLTKPGSMQQCS 420
            ..:.|..:.......:|.   ||..:|   .:|:|  ||..:            ||...|:|.||
  Fly   925 SASLIALDRSSSSESEWVAHPGCHSNCMTDSKGVQ--GVTSR------------LTGVESIQLCS 975

  Fly   421 TGIH---------------CGGSLNKVGGTIIVGS--SRSLNE 446
            ..|.               |.....||.|....|:  |.|::|
  Fly   976 YRIQPCERLQTAAEYAEQTCARYRQKVRGLSGHGAQISASIDE 1018

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559 17/60 (28%)
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559
IGc2 845..902 CDD:197706
PLAC 1355..1384 CDD:285849
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848
ZnMc_ADAMTS_like 331..543 CDD:239801
Reprolysin 332..545 CDD:279729
TSP1 683..741 CDD:214559 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13723
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.