DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and Adamtsl5

DIOPT Version :9

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:XP_038934914.1 Gene:Adamtsl5 / 314626 RGDID:1305607 Length:714 Species:Rattus norvegicus


Alignment Length:247 Identity:76/247 - (30%)
Similarity:95/247 - (38%) Gaps:65/247 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CLLDTQAAWAKKLNASQAFDDTWNTAS-DLENELEQQKRSKVQSAGGGGGAGGGPGQWSSWSDWS 85
            |||.||.:...:|.....| ..|...| ||.                  ||..|||:|:.|..||
  Rat   162 CLLGTQCSLRPRLFPPLLF-LLWILLSCDLR------------------GAAQGPGEWTLWGSWS 207

  Fly    86 TCSRTCDGGIMHQMRRC---GSPGSCRGESTRYRICNM----------QPCPEQQ-DFRSSQCSA 136
            .||.:|..|:..:.|.|   .....|.|:|..||:|.:          |.||... .||..|||.
  Rat   208 RCSSSCGRGVSVRRRHCVRLPEEELCWGDSHEYRVCQLPFYPSTFMLTQDCPPGAIPFRDLQCSL 272

  Fly   137 YNDVPYDGT--LYKWTPHYDYVEPCALTC--RGHPAHLVEDISRETGDGNAEEAEHYDEQSVIVQ 197
            ||..|..||  .|:|.|.:.....|.|.|  .||                           ....
  Rat   273 YNGHPVLGTQKTYQWVPFHGAPNLCDLNCLAEGH---------------------------AFYH 310

  Fly   198 LSARVQDGTRCRSGSLDMCIQGKCQRVGCDLKIGSTKKIDGCGVCGGDGNSC 249
            ...||.|||.|..|:..:|:.|:|...|||..:||....|.||:|||..:||
  Rat   311 SFGRVLDGTPCTPGTQGLCVAGRCLSAGCDGLLGSGTLEDRCGLCGGANDSC 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559 17/58 (29%)
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559
IGc2 845..902 CDD:197706
PLAC 1355..1384 CDD:285849
Adamtsl5XP_038934914.1 TSP1 200..246 CDD:214559 16/45 (36%)
ADAM_spacer1 444..541 CDD:368694
NTR_like 608..707 CDD:239600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.