DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and Adamts8

DIOPT Version :9

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:XP_003750503.1 Gene:Adamts8 / 300475 RGDID:1308511 Length:905 Species:Rattus norvegicus


Alignment Length:393 Identity:111/393 - (28%)
Similarity:153/393 - (38%) Gaps:82/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GQWSSWSDWSTCSRTCDGGIMHQMRRCGSPGS------CRGESTRYRICNMQPCPEQ-QDFRSSQ 133
            |.|..|..|..|||||.|||....|.|.:|..      |.||..:|:.|..:.||.. :.||..|
  Rat   543 GDWGPWGPWGQCSRTCGGGIQFSNRECDNPAPQNGGRFCLGERVKYQSCKTEECPPNGKSFREQQ 607

  Fly   134 C---SAYNDVPYDGTLYKWTPHYDYVEP---CALTCRGHPAHLVEDISRETGDGNAEEAEHYDEQ 192
            |   :|||....||...:|.|.|..|.|   |.|.||..              |.:|        
  Rat   608 CEKYNAYNHTDLDGNFLQWVPKYSGVSPRDRCKLFCRAR--------------GRSE-------- 650

  Fly   193 SVIVQLSARVQDGTRCRSGSLDMCIQGKCQRVGCDLKIGSTKKIDGCGVCGGDGNSCSQPLFNWE 257
              ......:|.|||.|...:|.:|::|:|.:.|||..:.|.||:|.||||||.|.:|.:  .:..
  Rat   651 --FKVFETKVIDGTLCGPDTLAICVRGQCVKAGCDHVVNSPKKLDKCGVCGGKGTACRK--VSGS 711

  Fly   258 MAPMS---QCSVTCGSG------YKMSRPICRN-------------RLTNADV------DDTLCS 294
            ..|.|   ...||..:|      .:.|.|..:|             .|.|.::      .|.|..
  Rat   712 FTPFSYGYNDIVTIPAGATNIDVKQRSHPGVQNDGSYLALKTANGQYLLNGNLAISAIEQDILMK 776

  Fly   295 VT----NRPEASVEQCNTHSCPPRWIADDWSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMCR 355
            .|    :...|::|:..:....|..:.....|.|   |..:..::.......|.....|.....|
  Rat   777 GTILKYSGSMATLERLQSFQALPEPLTVQLLTVS---GEVFPPKVKYTFFVPNDTDFNVQSSKER 838

  Fly   356 TPKPPTQETCIIEECPH--WEVEDWTGCSVSCGQGIQMRGVECKSTDGSLSAKCDPLTKPGSMQQ 418
            .      .|.||:..|:  |.:.||:.|..:||.|.|.|.|||:...|..|..||...||...:.
  Rat   839 A------STNIIQSLPYAEWVLGDWSECPSTCGGGWQRRTVECRDPSGQASDTCDEALKPEDAKP 897

  Fly   419 CST 421
            |.:
  Rat   898 CGS 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559 19/51 (37%)
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559
IGc2 845..902 CDD:197706
PLAC 1355..1384 CDD:285849
Adamts8XP_003750503.1 Pep_M12B_propep 49..152 CDD:279848
Reprolysin 234..444 CDD:279729
ZnMc_ADAMTS_like 234..441 CDD:239801
ADAM_CR 463..529 CDD:301627
TSP1 545..597 CDD:214559 19/51 (37%)
ADAM_spacer1 706..825 CDD:283607 19/123 (15%)
TSP1 852..903 CDD:214559 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11383
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.