DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and ADAMTS15

DIOPT Version :9

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:NP_620686.1 Gene:ADAMTS15 / 170689 HGNCID:16305 Length:950 Species:Homo sapiens


Alignment Length:462 Identity:129/462 - (27%)
Similarity:177/462 - (38%) Gaps:151/462 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GQWSSWSDWSTCSRTCDGGIMHQMRRCGSPGS------CRGESTRYRICNMQPCPEQ---QDFRS 131
            |.|:.|..:..|||||.||:....|:|.:|..      |.|...:||.||::|||..   :.||.
Human   517 GSWAKWDPYGPCSRTCGGGVQLARRQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFRE 581

  Fly   132 SQCSAYNDVPYDG---TL-YKWTPHYDYVEP---CALTCRGHPAHLVEDISRETGDGNAEEAEHY 189
            .||.|:|...:..   || ..|.|.|..|.|   |.|.||.:            |.|        
Human   582 EQCEAFNGYNHSTNRLTLAVAWVPKYSGVSPRDKCKLICRAN------------GTG-------- 626

  Fly   190 DEQSVIVQLSARVQDGTRCRSGSLDMCIQGKCQRVGCDLKIGSTKKIDGCGVCGGDGNSC----- 249
                ....|:.:|.|||.|...|..:|:||||.:.|||..:||.|:.|.|||||||..||     
Human   627 ----YFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCDGNLGSKKRFDKCGVCGGDNKSCKKVTG 687

  Fly   250 --SQPL--FNWEMA-PMSQCSVTCGS-GYK----------------------------------- 273
              ::|:  :|:.:| |....|:.... |||                                   
Human   688 LFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLIGDDNYLALKNSQGKYLLNGHFVVSAVERDLVV 752

  Fly   274 ------------------MSRPICR---------NRLTNADV----------------------- 288
                              .||||..         .::|...|                       
Human   753 KGSLLRYSGTGTAVESLQASRPILEPLTVEVLSVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRG 817

  Fly   289 ----DDTLCSVTNRPEASVEQCNTHSCPPRWIADDWSTCSRLCGHGYRERMVVCAEESNGIKTRV 349
                .:::.|::|:    |||.:... |.||:|..|..||..||.|.::|.|.| ..|.|.:|..
Human   818 PSVLHNSVLSLSNQ----VEQPDDRP-PARWVAGSWGPCSASCGSGLQKRAVDC-RGSAGQRTVP 876

  Fly   350 ADIMCRTPKPPTQETCIIEECPHWEVEDWTGCSVSCGQGIQMRGVECKSTDGSLSAK--CDPLTK 412
            |   |.....|.:.....|.||.||:..|:.||.|||:|.|.|.::|....|.|.|:  |:...|
Human   877 A---CDAAHRPVETQACGEPCPTWELSAWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRK 938

  Fly   413 PGSMQQC 419
            |..:..|
Human   939 PQELDFC 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559 19/51 (37%)
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559
IGc2 845..902 CDD:197706
PLAC 1355..1384 CDD:285849
ADAMTS15NP_620686.1 Pep_M12B_propep 24..142 CDD:307618
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..172
Cysteine switch. /evidence=ECO:0000250 172..179
ZnMc_ADAMTS_like 218..424 CDD:239801
ADAM_CR 437..506 CDD:326582
TSP1 519..571 CDD:214559 19/51 (37%)
ADAM_spacer1 683..801 CDD:310520 14/117 (12%)
Spacer 701..838 17/140 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 798..822 0/23 (0%)
TSP1 846..895 CDD:214559 16/52 (31%)
TSP1 897..950 CDD:214559 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.