DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and WFIKKN2

DIOPT Version :9

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:NP_783165.1 Gene:WFIKKN2 / 124857 HGNCID:30916 Length:576 Species:Homo sapiens


Alignment Length:304 Identity:61/304 - (20%)
Similarity:90/304 - (29%) Gaps:99/304 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 LCSPETKPEARV---RTCNDRPCPPRWNYSDYTPC------SKSC-------------GIGIKTR 707
            :|..:..|...|   .||. |.|........|..|      :|||             .:|: .:
Human    45 ICPNDMNPNLWVDAQSTCR-RECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGM-PK 107

  Fly   708 EVQCIHEVTRGGDNTMVVPNSMCPQPPPADRQYCNVLD------CPVRWE-----------VGEW 755
            |..|.|              .||.|    ....|::.|      |..|.|           :..:
Human   108 EATCDH--------------FMCLQ----QGSECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYY 154

  Fly   756 SKC---SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSAKPADKKPCNVKPCPPE-DPKPVIQ 816
            ::|   :..|..|.....|.|:      :....|.: .|........|....|..|| |......
Human   155 NRCYMDAEACSKGITLAVVTCR------YHFTWPNT-SPPPPETTMHPTTASPETPELDMAAPAL 212

  Fly   817 INNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKD--------HKPLQR 873
            :||..|       ..:|:          |..|...|.|....|.:|.|.|.        .:|...
Human   213 LNNPVH-------QSVTM----------GETVSFLCDVVGRPRPEITWEKQLEDRENVVMRPNHV 260

  Fly   874 SRKYKVSKKGALRILDITFRDAGVYSCH----AGLSSAEISIEV 913
            .....|:....|.|.:...:|||:|:|.    ||:..|:..:.|
Human   261 RGNVVVTNIAQLVIYNAQLQDAGIYTCTARNVAGVLRADFPLSV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559 10/70 (14%)
IGc2 845..902 CDD:197706 17/68 (25%)
PLAC 1355..1384 CDD:285849
WFIKKN2NP_783165.1 WAP 44..90 CDD:278522 12/45 (27%)
KAZAL_FS 138..174 CDD:238052 4/35 (11%)
I-set 216..304 CDD:254352 22/104 (21%)
Ig_3 224..304 CDD:143242 20/79 (25%)
Kunitz_BPTI 328..379 CDD:278443
Kunitz_BPTI 385..436 CDD:278443
NTR_WFIKKN 455..563 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.