DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and WFIKKN1

DIOPT Version :9

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:NP_444514.1 Gene:WFIKKN1 / 117166 HGNCID:30912 Length:548 Species:Homo sapiens


Alignment Length:290 Identity:57/290 - (19%)
Similarity:89/290 - (30%) Gaps:97/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 CNDRPCPPRWNYSDYTPCSKSCGIGIKTREVQC------------IHE-VTRGGDNTMVVPNS-- 728
            |.::..|..|..:..| |.:.|     :|:..|            :|. |......:...|.:  
Human    33 CPNQLSPNLWVDAQST-CEREC-----SRDQDCAAAEKCCINVCGLHSCVAARFPGSPAAPTTAA 91

  Fly   729 -----MCPQPPPADRQYCNVLD------CPVRWE-----------VGEWSKC---SHTCGYGFKD 768
                 :|||    ....|::.|      |..|.|           :..:::|   :..|..|...
Human    92 SCEGFVCPQ----QGSDCDIWDGQPVCRCRDRCEKEPSFTCASDGLTYYNRCYMDAEACLRGLHL 152

  Fly   769 RKVECKQIMAQEHKIERPESMCPSAKPADKKPCNVKPCPP---EDPKPVIQINNSTHIQHDPKKT 830
            ..|.||.:::..     |.|..|....|...| ...|.||   ..|.|.                
Human   153 HIVPCKHVLSWP-----PSSPGPPETTARPTP-GAAPVPPALYSSPSPQ---------------- 195

  Fly   831 KITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDH--------KPLQRSRKYKVSKKGALRI 887
              .::|||.        ..:.|.|.......:.|.|..        :|.|......|:..|.|.:
Human   196 --AVQVGGT--------ASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQMYGNVVVTSIGQLVL 250

  Fly   888 LDITFRDAGVYSC----HAGLSSAEISIEV 913
            .:....|||:|:|    .|||..|:..:.|
Human   251 YNARPEDAGLYTCTARNAAGLLRADFPLSV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559 13/70 (19%)
IGc2 845..902 CDD:197706 14/68 (21%)
PLAC 1355..1384 CDD:285849
WFIKKN1NP_444514.1 WAP 29..76 CDD:306578 9/48 (19%)
KAZAL_FS 120..155 CDD:238052 4/34 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..184 5/25 (20%)
Ig_3 200..280 CDD:143242 20/87 (23%)
KU 307..351 CDD:294074
Kunitz_BPTI 358..409 CDD:278443
NTR_WFIKKN 427..537 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.