DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and ADAMTS6

DIOPT Version :10

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:NP_922932.2 Gene:ADAMTS6 / 11174 HGNCID:222 Length:1117 Species:Homo sapiens


Alignment Length:144 Identity:41/144 - (28%)
Similarity:55/144 - (38%) Gaps:37/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IGAGPAGL----VAARELRREGHSVVVFEKQKQVGGTWIYTDEVESDPLSVDPTRSVVHSSVYRS 76
            ||..|.||    ..|.::..:..|.|     |.|..|.:..:||.:.|  |.||          .
Human   214 IGEEPWGLSQLDSGAGDISTDATSDV-----KIVIKTEVQEEEVVATP--VHPT----------D 261

  Fly    77 LRINGTRECTGY--RDFPFVVRSGVSRDR-RRFPSHGEVLAYLKDFAKEFGIEEMVRFETEVVKV 138
            |..:||....|.  |.||..|:.|....: ..|||...||          |:.|..|.|.::.::
Human   262 LEAHGTLFAPGQATRFFPSPVQEGAWESQGSSFPSQDPVL----------GLREPTRPERDIGEL 316

  Fly   139 SPA---AEEGIGKW 149
            |||   .|...|.|
Human   317 SPAIAQEEAPAGDW 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559 13/48 (27%)
TSP1_ADAMTS 256..311 CDD:465950
TSP1_ADAMTS 315..370 CDD:465950
TSP1_ADAMTS 373..420 CDD:465950
TSP1 546..600 CDD:214559
TSP1_ADAMTS 629..684 CDD:465950
TSP1_ADAMTS 688..746 CDD:465950
TSP1_ADAMTS 750..806 CDD:465950
Ig 845..914 CDD:472250
Ig strand B 848..852 CDD:409353
Ig strand C 861..865 CDD:409353
Ig strand E 883..887 CDD:409353
Ig strand F 897..902 CDD:409353
TSP1_ADAMTS 1157..1227 CDD:465950
TSP1_ADAMTS 1289..1343 CDD:465950
PLAC 1355..1384 CDD:462560
ADAMTS6NP_922932.2 Pep_M12B_propep 43..191 CDD:460254
ZnMc_ADAMTS_like 250..465 CDD:239801 30/103 (29%)
ADAMTS_CR_2 480..548 CDD:465496
TSP1 561..613 CDD:214559
ADAMTS_CR_3 618..716 CDD:437068
Spacer 717..843
ADAMTS_spacer1 719..829 CDD:461796
TSP1_ADAMTS 844..899 CDD:465950
TSP1_ADAMTS 903..959 CDD:465950
TSP1_ADAMTS 963..1017 CDD:465950
TSP1_ADAMTS 1022..1071 CDD:465950
PLAC 1083..1115 CDD:462560
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.