DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and XB995277

DIOPT Version :9

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:XP_031760531.1 Gene:XB995277 / 100487633 XenbaseID:XB-GENE-995278 Length:488 Species:Xenopus tropicalis


Alignment Length:250 Identity:68/250 - (27%)
Similarity:85/250 - (34%) Gaps:65/250 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NWTSPKIWAALFVTTLCLLDTQAAWAKKLNASQAFDDTWNTASDLENELEQQKRSKVQSAGGGGG 70
            ||.....:...|:...|  |||..                             .|..||   ||.
 Frog     5 NWFLAVFFITFFIHADC--DTQVT-----------------------------DSMYQS---GGI 35

  Fly    71 AGGGPGQWSSWSDWSTCSRTCDGGIMHQMRRC---GSPGSCRGESTRYRICNMQPCPEQQ-DFRS 131
            .....|||::|:.|::.|.||..|:..:.|||   .....|.||..:||.|....|||.. .||.
 Frog    36 TRPSKGQWTAWASWTSSSSTCGNGVAVRTRRCLRVTRMDRCAGEQRQYRSCQSGICPEDALPFRD 100

  Fly   132 SQCSAYNDVPYDGTL--YKWTPHYDYVEPCALTCRGHPAHLVEDISRETGDGNAEEAEHYDEQSV 194
            .||:.||..|..|:.  |||.|.|.....|.|.|..            .|..             
 Frog   101 LQCALYNYRPIPGSQRGYKWVPFYGAPTACHLNCLA------------VGQN------------- 140

  Fly   195 IVQLSARVQDGTRCRSGSLDMCIQGKCQRVGCDLKIGSTKKIDGCGVCGGDGNSC 249
            ......||.|||.|...|...||.|:|.:..|:....|....:.||.|....|:|
 Frog   141 FYYTFGRVLDGTSCGPNSNGTCINGQCLKADCNGIFTSEVSKESCGKCQEQQNTC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559 16/48 (33%)
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559
IGc2 845..902 CDD:197706
PLAC 1355..1384 CDD:285849
XB995277XP_031760531.1 TSP1 <56..92 CDD:214559 11/35 (31%)
ADAM_CR_2 99..168 CDD:407643 26/93 (28%)
ADAM_spacer1 207..309 CDD:368694
NTR 379..479 CDD:396359
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.