DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nolo and adamtsl5

DIOPT Version :9

Sequence 1:NP_001036374.1 Gene:nolo / 35424 FlyBaseID:FBgn0051619 Length:1394 Species:Drosophila melanogaster
Sequence 2:XP_002932288.1 Gene:adamtsl5 / 100379976 XenbaseID:XB-GENE-5867327 Length:525 Species:Xenopus tropicalis


Alignment Length:260 Identity:90/260 - (34%)
Similarity:109/260 - (41%) Gaps:67/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MNWTSPKIWAALFVTTLCLLDTQAAWAKKLNASQAFDDTWNTASDLENELEQQKRSKVQSAGGGG 69
            |.||...|...|  .|.|:|     |..|:..|.:                |.:|:..|   .|.
 Frog     1 MLWTCRLICHCL--ATACVL-----WIFKIVPSSS----------------QVQRNPFQ---WGF 39

  Fly    70 GAGGGP---------GQWSSWSDWSTCSRTCDGGIMHQMRRC-----GSPGSCRGESTRYRICNM 120
            ....||         .:||.|..||.|||||.||...:.|.|     ||| .|.||..:|::||.
 Frog    40 VNRFGPEHSPPLSSRNEWSVWHSWSPCSRTCGGGAAVRTRTCLIRDQGSP-MCPGEMRQYQVCNT 103

  Fly   121 QPCPE-QQDFRSSQCSAYNDVPYDGTLYKWTPHYDYVEPCALTCRGHPAHLVEDISRETGDGNAE 184
            |.||. ..|||..||||||..|..|..::|.|.|.....|.|:|.                  ||
 Frog   104 QDCPSGVADFRHFQCSAYNKKPLMGNYFRWVPFYSGQSDCELSCL------------------AE 150

  Fly   185 EAEHYDEQSVIVQLSARVQDGTRCRSGSLDMCIQGKCQRVGCDLKIGSTKKIDGCGVCGGDGNSC 249
            ....|..       ..||.|||.|.|....:||.|:|.::||||.:||.:|.|.||||||...||
 Frog   151 GQNFYYN-------FGRVLDGTSCHSDYDGLCINGQCLKIGCDLILGSEEKTDICGVCGGKNISC 208

  Fly   250  249
             Frog   209  208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
noloNP_001036374.1 TSP1 78..124 CDD:214559 24/50 (48%)
TSP1 546..600 CDD:214559
TSP1 750..807 CDD:214559
IGc2 845..902 CDD:197706
PLAC 1355..1384 CDD:285849
adamtsl5XP_002932288.1 TSP1 57..107 CDD:214559 24/50 (48%)
ADAM_spacer1 220..322 CDD:368694
NTR_like 408..511 CDD:382999
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.