DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF2 and CG2017

DIOPT Version :9

Sequence 1:NP_525105.2 Gene:eEF2 / 35422 FlyBaseID:FBgn0000559 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_649603.3 Gene:CG2017 / 40733 FlyBaseID:FBgn0037391 Length:643 Species:Drosophila melanogaster


Alignment Length:298 Identity:59/298 - (19%)
Similarity:102/298 - (34%) Gaps:57/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRGLMDKKRNIR-NMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETRFTDTRKDEQER--CI-- 68
            :|.:.|.:.||. .::|:...|.|||||...|..........:|....|....:.:..|  ||  
  Fly   204 VRKIPDDQHNIEVRVAVLGGADAGKSTLLGVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISH 268

  Fly    69 -TIKSTAISMYFEVEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDG---- 128
             |:...|:......:..:::.......|..:    |:..:|..||..:......||   .|    
  Fly   269 ETLGFDALGNVVNYKYNEMMTAEEISDRSSK----LVTFMDLAGHRRYMRTTVQAL---SGYSPH 326

  Fly   129 -ALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVI 192
             |::||...||....||..|  ||...:....|       :|..:.|......|.|.:...:..|
  Fly   327 YAMLVVSAGSGCNDTTEEHL--AIVRALDMPFF-------VLVTKTDITSPDATVQELCNLLTTI 382

  Fly   193 -------IATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKIDVVKLMNRL 250
                   :.|..|:....|..::..:...:...|.:.|....|              |.|.:..|
  Fly   383 GCRKVPFVVTNTDEAISAGSNQISENIVPIFCVSNVTGTGLNL--------------VTKFLYVL 433

  Fly   251 WGENFFNAKTKKWQKQKEADNKRSFCMYILDPIYKVFD 288
             .....||:..:.:::.        |.:.:|.|::|.|
  Fly   434 -SPGISNAEKDRLEQES--------CEFQVDEIFRVSD 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF2NP_525105.2 PTZ00416 1..844 CDD:240409 59/298 (20%)
EF2 20..236 CDD:206672 45/233 (19%)
EF2_snRNP_like_II 380..474 CDD:293901
EF2_snRNP_III 489..560 CDD:293918
aeEF2_snRNP_like_IV 560..732 CDD:238839
eEF2_snRNP_like_C 728..807 CDD:239763
CG2017NP_649603.3 GTPBP1 100..635 CDD:227583 59/298 (20%)
GTPBP1_like 217..436 CDD:206728 48/249 (19%)
GTPBP_II 450..536 CDD:293895 5/13 (38%)
GTPBP_III 547..634 CDD:294007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.