DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul2 and AT1G59800

DIOPT Version :9

Sequence 1:NP_610117.1 Gene:Cul2 / 35420 FlyBaseID:FBgn0032956 Length:753 Species:Drosophila melanogaster
Sequence 2:NP_176189.1 Gene:AT1G59800 / 842273 AraportID:AT1G59800 Length:255 Species:Arabidopsis thaliana


Alignment Length:284 Identity:59/284 - (20%)
Similarity:114/284 - (40%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PKIVEFVDVWPRLRCIAESVITLTKVE------RSVWNTSFSDVYTLCVAQPEPMADRLYGETKH 63
            |..::|...|..::.....:|.:.:.|      :.:.....:..|.:| |...|  .:||.:.:.
plant     4 PTEIKFEVEWSNIQQGFTKLIRMIEGESEPAFNQEIMMMMHTATYRIC-AYKNP--QQLYDKYRE 65

  Fly    64 FLEQH-VQEMLAKKVLIEGECSHSNGGPDLLQRYYITWMEYSQGIKYLHQLYIYLNQQHIKKQKI 127
            .:|.: :|.:|........||        :|:.....|..:...::...:..:||:...:.|:.:
plant    66 LIENYAIQTVLPSLREKHDEC--------MLRELAKRWNAHKLLVRLFSRRLVYLDDSFLSKKGL 122

  Fly   128 TDTESFYGNLSSDAAEQMEIGELGLDIWRLYMIEYLSSELVRHIL-------EGIAADRASNGTL 185
            .                 .:.|:||:.:|..:...:.|.....||       ||...||      
plant   123 P-----------------SLREVGLNCFRDQVYREMQSMAAEAILALIHKEREGEQIDR------ 164

  Fly   186 DHHRVQIINGVIHSFVEVQDYKKTGSLKLYQELFEGPMLEASGAYYTDEANKLLHRCSVSEYMQE 250
                 :::..||..|||    ...|:||.|:|.||..||:.:.:||:.:|::.:...|..:|..:
plant   165 -----ELVRNVIDVFVE----NGMGTLKKYEEDFERLMLQDTASYYSSKASRWIQEESCLDYTLK 220

  Fly   251 VIRILEYESRRAQKFLHVSSLPKL 274
            ..:.|:.|..|...:||.::.|||
plant   221 PQQCLQRERERVTHYLHPTTEPKL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul2NP_610117.1 Cullin 39..639 CDD:279260 54/244 (22%)
CULLIN 436..575 CDD:214545
Cullin_Nedd8 680..745 CDD:214883
AT1G59800NP_176189.1 Cullin 41..>255 CDD:279260 54/247 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.