DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul2 and AT3G46910

DIOPT Version :10

Sequence 1:NP_610117.1 Gene:Cul2 / 35420 FlyBaseID:FBgn0032956 Length:753 Species:Drosophila melanogaster
Sequence 2:NP_190275.1 Gene:AT3G46910 / 823844 AraportID:AT3G46910 Length:247 Species:Arabidopsis thaliana


Alignment Length:203 Identity:42/203 - (20%)
Similarity:75/203 - (36%) Gaps:61/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TWMEYSQGIKYLHQL-------YIYLNQQHIKKQKITDTESFYGNL---------------SSDA 141
            :|.|.|.| :.|::|       ||....|.::.|..||...|...|               |...
plant    60 SWCEKSSG-EALYKLILEECEIYISAAIQSLESQCDTDPSLFLSLLEKCWLDFRRKLQFLCSIAG 123

  Fly   142 AEQMEIG-----ELGLDI--WRLYMIEYLSSELVRHILEGIAADRA---------SNGT---LDH 187
            .|...:|     :||.::  ..|:..:.:..:|:..||:.|...|:         .|.|   :..
plant   124 GEGQTVGPHSVWDLGSELSPKHLFSAQKVRDKLLSIILQLIRDQRSFMSVDMTQLKNTTRPVMSV 188

  Fly   188 HRVQIIN--GVIHSFVEVQDYKKTGSLKLYQE-LFEGPMLEASGAYYTDEANKLLHRCSVSEYMQ 249
            |..|:.|  |:.:            ...||:. .|:.|.::.:..:|:.||.:...:..:..|::
plant   189 HMTQLNNLRGLFY------------GQSLYKSPFFKKPFIDCAVEFYSAEAMQFKEQSDIPLYLK 241

  Fly   250 EVIRILEY 257
            .|    ||
plant   242 RV----EY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul2NP_610117.1 Cullin 14..652 CDD:459983 42/203 (21%)
Cullin_Nedd8 683..745 CDD:463146
AT3G46910NP_190275.1 Cullin 30..>244 CDD:459983 40/200 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.