DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul2 and CACUL1

DIOPT Version :9

Sequence 1:NP_610117.1 Gene:Cul2 / 35420 FlyBaseID:FBgn0032956 Length:753 Species:Drosophila melanogaster
Sequence 2:NP_722517.3 Gene:CACUL1 / 143384 HGNCID:23727 Length:369 Species:Homo sapiens


Alignment Length:119 Identity:28/119 - (23%)
Similarity:55/119 - (46%) Gaps:27/119 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WPRLRCIAESVITLTKVERSVWNTSFSDVYTL---CVAQPEPMADRLYGE-----TKHFLEQHVQ 70
            ||:|....:.:  ||:........|:..:|:.   ||.|..  ::::|.:     |.| ||:..:
Human   137 WPKLDGAIDQL--LTQSPGDYIPISYEQIYSCVYKCVCQQH--SEQMYSDLIKKITNH-LERVSK 196

  Fly    71 EMLAKKVLIEGECSHSNGGPDL-LQRYYITWMEYSQGIKYLHQLYIYLNQQHIK 123
            |:.|..             ||| ::|:.|...:|...::.:..|:||:|:.:|:
Human   197 ELQASP-------------PDLYIERFNIALGQYMGALQSIVPLFIYMNKFYIE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul2NP_610117.1 Cullin 39..639 CDD:279260 22/94 (23%)
CULLIN 436..575 CDD:214545
Cullin_Nedd8 680..745 CDD:214883
CACUL1NP_722517.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Cullin 138..>256 CDD:279260 27/118 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.