DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and CG34357

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster


Alignment Length:315 Identity:86/315 - (27%)
Similarity:146/315 - (46%) Gaps:50/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   851 VAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFYS 915
            :.|:.|..:..|::.|.|:..:||..|||.......     :..:.:::|.:.|:.:..|:..  
  Fly  1065 IRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLA-----VDPEEFSDVTIYFSDIVGFTTI-- 1122

  Fly   916 EETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGINVQRTVRNDAPITER 980
              ..:...::.:..||::.:.|||.:..   .::.|::|||..||..||:.|:      .|    
  Fly  1123 --AAHCSPVQVVDLLNDLYTIFDATINA---YNVYKVETIGDAYMVVSGLPVK------IP---- 1172

  Fly   981 WSHLAILVEFALELKHALQSINEQSFNH-----FVLKMGINHGPITAGVIGARKPHYDIWGNTVN 1040
             .|...:...||:|.|.....|   ..|     ..|::|::.||..|||:|...|.|.::|:|||
  Fly  1173 -DHAEQIATMALDLLHQSGRFN---VKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVN 1233

  Fly  1041 VASRMESTGKAGAIQVTEETCNIL-RLFGYTFLQRGLVAVKGKGQLMTFYLQGKSQ-SSAEPVAS 1103
            .||||||||.:..|.:::||.:.| ...||....|||:.:||||.:.||:|.||.. ....|...
  Fly  1234 TASRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPP 1298

  Fly  1104 GVVVLNGQDSSAVESTSELEASDIKMPLLKMNGPEQSLEIDQDRSLRNDSAGQES 1158
            .:...:|.|.|.:.::..|:|                 :.::.|:..|.|:.|.|
  Fly  1299 PIGESHGLDESLIRNSITLKA-----------------QANKSRTSTNPSSSQSS 1336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 61/216 (28%)
Guanylate_cyc 892..1092 CDD:278633 63/205 (31%)
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 61/217 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.