DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and Gucy1b1

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_059497.1 Gene:Gucy1b1 / 54195 MGIID:1860604 Length:620 Species:Mus musculus


Alignment Length:305 Identity:81/305 - (26%)
Similarity:148/305 - (48%) Gaps:41/305 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 ATAALIGLLYYFMGEAK--QKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLG 284
            ||..|:.|...|..|.|  |:...|..:..|.:: .:|::..:.:.||.||||..||.::|..  
Mouse   348 ATRDLVLLGEQFREEYKLTQELEILTDRLQLTLR-ALEDEKKKTDTLLYSVLPPSVANELRHK-- 409

  Fly   285 SSSSEAFKKIYMSRHENVSILYADIVGFTAISSTYS----AQDLVKMLNELFARFDRLAEKYQQ- 344
                   :.:...|::||:||::.||||.|..|.::    |..:|.:||:|:.|||.|.:..:. 
Mouse   410 -------RPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNP 467

  Fly   345 --LRIKILGDCYYCISGAPDERPDHAVLCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAG 407
              .:::.:||.|..:||.|:....||....|:.|.|::....||....| |.:.:|||||.|:.|
Mouse   468 FVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGES-VQITIGIHTGEVVTG 531

  Fly   408 ILGQRQWQFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEAAFGEKREELLRIAGLK 472
            ::|||..::.::...|.|.::.|::|:.|::::|:.|...|...        |..:.|..:    
Mouse   532 VIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSP--------ENSDPLFHL---- 584

  Fly   473 TYFITKVVKAFASPCAKKINETQAEIAHPNPNGSTTDIVSDEDDN 517
                     ....|.:.|..:...::...:...:.|:..::||:|
Mouse   585 ---------EHRGPVSMKGKKEPMQVWFLSRKNTGTEETNEEDEN 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831 20/64 (31%)
CYCc 256..453 CDD:214485 63/203 (31%)
Guanylate_cyc 294..476 CDD:278633 55/188 (29%)
CYCc 860..1071 CDD:214485
Guanylate_cyc 892..1092 CDD:278633
Gucy1b1NP_059497.1 HNOB 2..166 CDD:311572
HNOBA 207..406 CDD:311573 19/58 (33%)
Guanylate_cyc 412..605 CDD:306677 57/214 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.