DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and Phlpp2

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_001102601.2 Gene:Phlpp2 / 498949 RGDID:1562857 Length:1359 Species:Rattus norvegicus


Alignment Length:354 Identity:65/354 - (18%)
Similarity:114/354 - (32%) Gaps:137/354 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   696 TFVRTEHIVSESEFNVTASLESDINLVVEGMVTAEHLLPASFV---------------EQMRDAV 745
            |...|....|.|..:.::|..||::||   :.|.|  .|||.:               :.:|...
  Rat    75 TTTATTTTTSSSSSSSSSSSSSDLHLV---LCTVE--TPASEICAGEGRESLYLQLHGDLVRRLE 134

  Fly   746 PTER---VLYPSYLSNFGVLILIAIAVIAQLTHLTKILLLLSIAALHCYFNIFIMQDLYALEDDF 807
            ||||   ::| .|||..|                                    .:|...::::.
  Rat   135 PTERPLQIVY-DYLSRLG------------------------------------FEDPVRIQEEA 162

  Fly   808 EHQPIISTRYAASGLLLVAALALSTLAR-------HMDHEDRVIFKWKTEVAEQKETANDMRQRN 865
            .:..                  ||.:.|       .|||.||::......|.:.|...:...:|.
  Rat   163 TNPD------------------LSCMIRFYGEKPCQMDHLDRILLSGIYNVRKGKTQLHKWAERL 209

  Fly   866 EALV----------------YNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFY 914
            ..|.                .::||: |.....:..:|.|...:|.:.|:......|....:::.
  Rat   210 VVLCGTCLIVSSVKDCQTGKMHILPL-VGGKIEEVKRRQHSLAFSSAGAQAQTYHVSFETLAEYQ 273

  Fly   915 SEETVNNQGLECLRFLNEVISDFD----ALLELPQF----QDIIKIKTIGSTYMAASGINVQRTV 971
            ..:.      :..:.:::.||..|    :|.|:|:.    |||        ||:         .:
  Rat   274 RWQR------QASKVVSQRISTVDLSCYSLEEVPEHLFYSQDI--------TYL---------NL 315

  Fly   972 RNDAPITERWSHLAILVEFA----LELKH 996
            |::....||...|..|.:|:    |.|.|
  Rat   316 RHNFMQLERPGGLDTLYKFSQLKGLNLSH 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 30/165 (18%)
Guanylate_cyc 892..1092 CDD:278633 23/117 (20%)
Phlpp2NP_001102601.2 RA_PHLPP2 66..178 CDD:340761 28/162 (17%)
PH_PHLPP-like 185..279 CDD:270131 14/100 (14%)
PLN00113 284..>762 CDD:215061 20/78 (26%)
leucine-rich repeat 289..309 CDD:275380 4/19 (21%)
leucine-rich repeat 310..336 CDD:275380 9/42 (21%)
leucine-rich repeat 337..359 CDD:275380 3/8 (38%)
leucine-rich repeat 360..382 CDD:275380
leucine-rich repeat 383..405 CDD:275380
leucine-rich repeat 406..428 CDD:275380
leucine-rich repeat 429..452 CDD:275380
leucine-rich repeat 453..476 CDD:275380
leucine-rich repeat 477..497 CDD:275380
leucine-rich repeat 498..517 CDD:275380
leucine-rich repeat 518..539 CDD:275380
leucine-rich repeat 540..562 CDD:275380
leucine-rich repeat 563..584 CDD:275380
leucine-rich repeat 586..607 CDD:275380
leucine-rich repeat 608..631 CDD:275380
leucine-rich repeat 632..681 CDD:275380
leucine-rich repeat 682..705 CDD:275380
leucine-rich repeat 706..728 CDD:275380
leucine-rich repeat 751..772 CDD:275380
PP2Cc 820..1069 CDD:238083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.