DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and CG14877

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:154 Identity:35/154 - (22%)
Similarity:55/154 - (35%) Gaps:35/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 SSLPLLAA---LLVQCIDVL------YSYLVLPRSTLHFINIAAPLVPIAMLVVISLAESFSGML 654
            :||.::.|   ::.||..|:      ||...:.|.|.:|.:...||:.:             |..
  Fly    95 ASLGVIKAMDGIIKQCAQVIFGPVCDYSLAAVSRITKYFNSQGTPLISV-------------GGS 146

  Fly   655 PKFFVDVSKRFNDITFVRELAAIIIALTIGFSNVIDMFFFVTFVRTEHIVSESEFNVTASLESDI 719
            ...|.......||     |...::....:.|..:.::   ...|...|..|.|.|    ..|.|.
  Fly   147 TYDFEQKKTDCND-----EFYMLLRTGMLSFETISEL---TINVMKRHNWSHSIF----YYERDG 199

  Fly   720 NLVVEGMVTAEHLLPASFVEQMRD 743
            ...|.||.|. .|:..|..:|||:
  Fly   200 QRSVAGMHTC-FLMMKSLGKQMRN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485
Guanylate_cyc 892..1092 CDD:278633
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 35/154 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.