DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and CG31183

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:247 Identity:78/247 - (31%)
Similarity:141/247 - (57%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   851 VAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFYS 915
            |.|:.:..::.:::.|.|:|.:||..||...:     |...:.::::.:|.:.|:.:..|:...:
  Fly   908 VEERTQDYHEEKKKCEKLLYQLLPQSVAAQLI-----SGQPVVAETFDQVTIYFSDIVGFTAISA 967

  Fly   916 EETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGINVQRTVRNDAPITER 980
            |.|    .::.::|||::.:.||:::|  .| |:.|::|||..||..||:          ||...
  Fly   968 EST----PMQVVQFLNDLYTCFDSIVE--NF-DVYKVETIGDAYMVVSGL----------PIRNG 1015

  Fly   981 WSHLAILVEFALELKHALQS--INEQSFNHFVLKMGINHGPITAGVIGARKPHYDIWGNTVNVAS 1043
            ..|...:...||.|..|:.:  |:.:..:...|::|::.|...|||:|.:.|.|.::|:|||.||
  Fly  1016 NQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTAS 1080

  Fly  1044 RMESTGKAGAIQVTEETCNILRLFGYTFL--QRGLVAVKGKGQLMTFYLQGK 1093
            ||||.|:|..|.::|.|...|..|| ||:  :||.|.:||||:::|::|:|:
  Fly  1081 RMESNGEALKIHISETTKEALDEFG-TFVTTRRGFVPMKGKGEMLTYWLEGE 1131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 64/212 (30%)
Guanylate_cyc 892..1092 CDD:278633 67/203 (33%)
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 9/29 (31%)
CYCc 917..1108 CDD:214485 65/213 (31%)
Guanylate_cyc 944..1130 CDD:278633 67/203 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.