DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and CG3216

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster


Alignment Length:350 Identity:97/350 - (27%)
Similarity:168/350 - (48%) Gaps:64/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   796 IMQDLYALEDDFEHQPIIST-----RYAASGLL--LVAALALSTLARHMDHEDRVIFKWKTEVAE 853
            :|:..:|  |:.|.:|..||     |....|..  |:..| |:.:.::.::.:.::.:...:::.
  Fly   857 LMEKCWA--DNQEERPTFSTIRSNIRTIMKGFCENLMDDL-LNRMEQYANNLESLVEEKTRQLSL 918

  Fly   854 QKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFYSEET 918
            :|       ||.|.|:|.:||..||:..|     :.|.:..:.::.|.:.|:.:..|    :|..
  Fly   919 EK-------QRTEELLYQILPRPVAQQLM-----AGDLVEPEEFSSVTIYFSDIVGF----TELC 967

  Fly   919 VNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGINVQRTVRNDAPITERWSH 983
            ..:..::.:.|||::.|.||.::   .|.|:.|::|||..|:..||:          |......|
  Fly   968 ARSSPMDVVNFLNDLYSTFDRII---GFYDVYKVETIGDAYLVVSGL----------PEPNGDKH 1019

  Fly   984 LAILVEFALELKHALQSINEQSFNH-----FVLKMGINHGPITAGVIGARKPHYDIWGNTVNVAS 1043
            ...:...||::..|:.|.|   ..|     ..:::|::.|.:.|||:|.:.|||.::|:|||.||
  Fly  1020 AREIALMALDILRAVSSFN---LRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTAS 1081

  Fly  1044 RMESTGKAGAIQVTEETCNILRLFG-YTFLQRGLVAVKGKGQLMTFYLQGKSQSSAEPVASGVVV 1107
            ||||||:.|.|.|:..|..||..|| :...|||.|.:||||.:.|::|...|:..|.|....:  
  Fly  1082 RMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWLNSTSEGEARPPTPQI-- 1144

  Fly  1108 LNGQDSSAVESTSELEASDIKMPLL 1132
                          |...::..|||
  Fly  1145 --------------LTTDEVPFPLL 1155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 67/216 (31%)
Guanylate_cyc 892..1092 CDD:278633 66/205 (32%)
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 8/29 (28%)
TyrKc 627..877 CDD:197581 7/21 (33%)
HNOBA <882..939 CDD:285003 14/64 (22%)
CYCc 918..1109 CDD:214485 68/222 (31%)
Guanylate_cyc 945..1131 CDD:278633 66/205 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.