DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and GUCY2D

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_000171.1 Gene:GUCY2D / 3000 HGNCID:4689 Length:1103 Species:Homo sapiens


Alignment Length:255 Identity:80/255 - (31%)
Similarity:121/255 - (47%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   851 VAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFYS 915
            :.|:.|.....:|:.:.|:..:||..|||.....|.      ....|.|...|:     |||...
Human   835 IRERTEELELEKQKTDRLLTQMLPPSVAEALKTGTP------VEPEYFEQVTLY-----FSDIVG 888

  Fly   916 EETVN--NQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGI---NVQRTVRNDA 975
            ..|::  ::.:|.:..||::.:.|||::   ...|:.|::|||..||.|||:   |.||      
Human   889 FTTISAMSEPIEVVDLLNDLYTLFDAII---GSHDVYKVETIGDAYMVASGLPQRNGQR------ 944

  Fly   976 PITERWSHLAILVEFALELKHALQSINEQSFNHFV-----LKMGINHGPITAGVIGARKPHYDIW 1035
                   |.|.:...:|::   |.::......|..     :::|::.||..|||:|...|.|.::
Human   945 -------HAAEIANMSLDI---LSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLF 999

  Fly  1036 GNTVNVASRMESTGKAGAIQVTEETCNILRLF--GYTFLQRGLVAVKGKGQLMTFYLQGK 1093
            |:|||.||||||||....|.|...|..|||..  ||....||...:||||...||:|.|:
Human  1000 GDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGR 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 68/222 (31%)
Guanylate_cyc 892..1092 CDD:278633 69/211 (33%)
GUCY2DNP_000171.1 PBP1_sensory_GC_DEF-like 55..431 CDD:380594
PK_GC-2D 536..811 CDD:270945
HNOBA <820..865 CDD:369471 9/29 (31%)
CYCc 846..1036 CDD:214485 67/219 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1065..1103
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.