DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and GUCY2C

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_004954.2 Gene:GUCY2C / 2984 HGNCID:4688 Length:1073 Species:Homo sapiens


Alignment Length:359 Identity:98/359 - (27%)
Similarity:156/359 - (43%) Gaps:78/359 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   799 DLYAL-----EDDFEHQP----IISTRYAASGLL-----------LVAALALSTLARHMDHEDRV 843
            ::|.|     |:|.|.:|    |.:|.....||.           |:..|.|  .:|:::|    
Human   719 EVYLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQL--YSRNLEH---- 777

  Fly   844 IFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMP 908
                  .|.|:.:.....|.|.:.|.:.:||..|    :|:.|.. ..:..:.|.||.:.|:.:.
Human   778 ------LVEERTQLYKAERDRADRLNFMLLPRLV----VKSLKEK-GFVEPELYEEVTIYFSDIV 831

  Fly   909 NFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGINVQRTVRN 973
            .|:......|    .:|.:..||::...||.:::   ..|:.|::|||..||.|||:..:...| 
Human   832 GFTTICKYST----PMEVVDMLNDIYKSFDHIVD---HHDVYKVETIGDAYMVASGLPKRNGNR- 888

  Fly   974 DAPITERWSHLAILVEFALELKHALQSINEQSFNHFV-----LKMGINHGPITAGVIGARKPHYD 1033
                     |...:.:.|||:   |..:......|..     :::|::.||..|||:|.:.|.|.
Human   889 ---------HAIDIAKMALEI---LSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYC 941

  Fly  1034 IWGNTVNVASRMESTGKAGAIQVTEETCNILRLFGYTFLQ--RGLVAVKGKGQLMTFYLQG-KSQ 1095
            ::|:|||.||||||||....|.|:..|..||:.....||.  ||...:||:|...|::|.| |.|
Human   942 LFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQ 1006

  Fly  1096 SSAEPVASGVVVLNGQDSSAVESTSELEA--SDI 1127
            .           .|......||:...|:|  ||:
Human  1007 K-----------FNLPTPPTVENQQRLQAEFSDM 1029

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 62/215 (29%)
Guanylate_cyc 892..1092 CDD:278633 63/206 (31%)
GUCY2CNP_004954.2 PBP1_GC_C_enterotoxin_receptor 35..415 CDD:107364
PK_GC-C 480..750 CDD:270946 8/30 (27%)
Pkinase_Tyr 502..745 CDD:285015 7/25 (28%)
CYCc 788..979 CDD:214485 62/215 (29%)
Guanylate_cyc 815..1002 CDD:278633 63/206 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.