DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and Npr3

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:519 Identity:100/519 - (19%)
Similarity:175/519 - (33%) Gaps:156/519 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 VEGMVTAEHLLPASFVEQMR---------------DAVPTERVLYPSYLSNFGVLILIAIAVIAQ 772
            |||..|...|||.....|:.               |.|...|...|..:  .|.:...|.|.:|:
  Rat   194 VEGNGTGRKLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLI--LGPVCEYAAAPVAR 256

  Fly   773 L-THLTKILLLLSIAALHCYFNIFIMQDLYALEDDFEHQPIISTRYAASGLLLVAALALSTLARH 836
            | :|..  |.:||..||...|.        ..:.::.|...::..||..|.:::|      |.||
  Rat   257 LASHWD--LPMLSAGALAAGFQ--------HKDTEYSHLTRVAPAYAKMGEMMLA------LFRH 305

  Fly   837 MDHEDRVIFKWKTEVAEQKETANDMRQRN-----EAL--VYNVLPVHVAEHFMKNTK-RSHDDL- 892
             .|..|....:          ::|..:||     |.:  |:....:|.:.:....|| ...||: 
  Rat   306 -HHWSRAALLY----------SDDKLERNCYFTLEGVHEVFQEEGLHTSAYNFDETKDLDLDDIV 359

  Fly   893 -YSQSYAEVGVLFASMPNFS----------------DFYSEETVNNQGLECLRFLNEVISDFDAL 940
             |.|....|.::.||.....                .|::.|..|:.......:......||:| 
  Rat   360 RYIQGSERVVIMCASGDTIRRIMLAVHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEA- 423

  Fly   941 LELPQFQDIIKIKTIGSTYMAASGINVQRTVRNDAPITERWSHLAILVEFALELKHAL--QSINE 1003
                           ...|.:...:.:.||.:   |..|:         |::|:|.::  |.:||
  Rat   424 ---------------KQAYSSLQTVTLLRTAK---PEFEK---------FSMEVKSSVEKQGLNE 461

  Fly  1004 QSF-NHFV--------LKMGINHGPITAGVIGARKPHYDI----WGNT-------VNVASRMEST 1048
            :.: |.||        |.:...|..:.||.  ::|....|    |..|       |::.:..:..
  Rat   462 EDYVNMFVEGFHDAILLYVLALHEVLRAGY--SKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRY 524

  Fly  1049 GKAGAIQVTEETCNILRLFGYTFLQRGLVAVKGKGQLMTFYLQGKSQSSAEPVASGVVVLNGQDS 1113
            |....:.:|:.......:.|..|.:.|...::...:    |..|..:...:...    ::...:|
  Rat   525 GDFSVVAMTDTEAGTQEVIGDYFGKEGRFKMRSNVK----YPWGSLKLRIDETR----IVEHTNS 581

  Fly  1114 SAVESTSELEASDI------------------------KMPLLKMNGPEQSLEIDQDRSLRNDS 1153
            |..:|:..||.|.:                        ::.:.:.|..|:| .|.:.|.||.||
  Rat   582 SPCKSSGGLEESAVTGIVVGALLGAGLLMAFYFFRKKYRITIERRNHQEES-NIGKHRELREDS 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 47/258 (18%)
Guanylate_cyc 892..1092 CDD:278633 40/239 (17%)
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381 83/420 (20%)
ANF_receptor 182..535 CDD:279440 80/399 (20%)
TM_EphA1 587..618 CDD:214014 3/30 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.