DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and Gucy1b2

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:XP_011243363.2 Gene:Gucy1b2 / 239134 MGIID:2660873 Length:829 Species:Mus musculus


Alignment Length:426 Identity:103/426 - (24%)
Similarity:177/426 - (41%) Gaps:94/426 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 QPSFSPRDLLGWAILLNFLVYVTLP----LQLIFLGLSIGCITYFICLSLPVGYSHWDSLLSNQL 214
            ||:...|..:.|...|..:|::..|    ||                 .|.....|...:..:..
Mouse   461 QPTLKLRGQMIWMESLKCMVFMCSPKLRSLQ-----------------ELEESKMHLSDIAPHDT 508

  Fly   215 AANAVLIATAALIGLLYYFMGEAKQKRAFLEAKKSLEVK----------MVIEEQSAEQERLLLS 269
            ..:.:|:               .:|:.|.:|....||.|          :.||::  :.|.||.:
Mouse   509 TRDLILL---------------NQQRLAEMELSCQLEKKKEELRVLSNHLAIEKK--KTETLLYA 556

  Fly   270 VLPKHVAIKMREDLGSSSSEAFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFAR 334
            :||:|||.:::|.         ||:.....|..:||::|:|.||.|.:......:|.|||.::::
Mouse   557 MLPEHVANQLKEG---------KKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSK 612

  Fly   335 FDRLAEKYQQLRIKILGDCYYCISGAPDERPDHAVLCVHMGLSM-VKAIKYVQQKANSPVDMRVG 398
            ||||...:...:::.:||.|..:.|.|.....||....:..|.| :.|.:.:......|:.:|||
Mouse   613 FDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVTGEPIQIRVG 677

  Fly   399 IHTGAVLAGILGQRQWQFDVYSKDVELANKMESSGKAGRVHISDKT-LAFLNGEFEVEAAFGEKR 462
            ||||.||||::|.:..::.::...|..|::|||.|...:||:|... .|..|..||: ...||  
Mouse   678 IHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRALENKGFEI-VTRGE-- 739

  Fly   463 EELLRIAG---LKTYFITK-----VVKAFASPCA----KKINETQAEIAHPNPNGSTTDIVSDED 515
               :.:.|   :.|||:.:     .|:....|.|    |:.:..:.::..|..      ::|:.|
Mouse   740 ---IEVKGKGKMTTYFLIRNLNATEVEIMGRPSALADGKEASTPRNQVKKPRA------VLSNMD 795

  Fly   516 DNDATLDDEELLAQNSVSNGHQIGIAVTADEEEQVK 551
            .:           |..|.|.....:..||.....||
Mouse   796 HH-----------QQQVYNSDPADVLGTASRTASVK 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831 29/144 (20%)
CYCc 256..453 CDD:214485 63/198 (32%)
Guanylate_cyc 294..476 CDD:278633 57/186 (31%)
CYCc 860..1071 CDD:214485
Guanylate_cyc 892..1092 CDD:278633
Gucy1b2XP_011243363.2 HNOB 115..276 CDD:400167
HNOBA 380..566 CDD:400168 28/138 (20%)
Guanylate_cyc 572..754 CDD:306677 58/187 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.