DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and gcy-23

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_500309.3 Gene:gcy-23 / 191652 WormBaseID:WBGene00001548 Length:1073 Species:Caenorhabditis elegans


Alignment Length:318 Identity:91/318 - (28%)
Similarity:144/318 - (45%) Gaps:47/318 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   796 IMQDLYAL-----EDDFEHQPII-STRYAASGLLLVAALALSTLARHMDHEDRVIFKWKTEVAEQ 854
            |..||.||     .::.|.:|.| ..|......|.|....:..:.|.|:.....:.|.   |||:
 Worm   775 IHPDLVALLLDCWNENPEVRPSIRRVRLNTENYLKVKGSLVDQMMRMMEQYANNLEKL---VAER 836

  Fly   855 KETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFYSEETV 919
            .....:...|.:.|:..:||.:||     |..:....:.::::....|:|:.:..|:...|..| 
 Worm   837 TGMLEEANVRADKLLGQLLPKYVA-----NELKMGRSVPAKTFDMATVMFSDIVGFTTICSSST- 895

  Fly   920 NNQGLECLRFLNEVISDFDALLELPQFQDII------KIKTIGSTYMAASGINVQRTVRNDAPIT 978
               .||.:..||.:.|.||         |.|      |::|||..||..|||          |..
 Worm   896 ---PLEVVSMLNSIYSKFD---------DAINKHGSYKVETIGDAYMIVSGI----------PEE 938

  Fly   979 ERWSHLAILVEFALELKHALQS--INEQSFNHFVLKMGINHGPITAGVIGARKPHYDIWGNTVNV 1041
            ....|:..:...||||...|::  |..:......:::||:.|.:.|||:|...|.|.::|:||||
 Worm   939 NGNEHIRNICNTALELMLLLKTYEIPHRRNVKLRIRLGIHTGTVAAGVVGLTAPRYCLFGDTVNV 1003

  Fly  1042 ASRMESTGKAGAIQVTEETCNI-LRLFG-YTFLQRGLVAVKGKGQLMTFYLQGKSQSS 1097
            |||||||.:...||:::|..:. :|.:. :....||.|..||||.:.:::|.||...|
 Worm  1004 ASRMESTSEPEKIQMSQEARDFCVRYYSEFQITLRGTVEAKGKGPVTSYWLLGKQSES 1061

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 63/220 (29%)
Guanylate_cyc 892..1092 CDD:278633 64/209 (31%)
gcy-23NP_500309.3 Periplasmic_Binding_Protein_Type_1 38..407 CDD:299141
ANF_receptor 38..385 CDD:279440
PK_GC 509..806 CDD:270894 9/30 (30%)
HNOBA <817..863 CDD:285003 13/53 (25%)
CYCc 842..1035 CDD:214485 63/220 (29%)
Guanylate_cyc 869..1056 CDD:278633 64/209 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.