DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and Npr3

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:513 Identity:102/513 - (19%)
Similarity:181/513 - (35%) Gaps:144/513 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 VEGMVTAEHLLPASFVEQMR---------------DAVPTERVLYPSYLSNFGVLILIAIAVIAQ 772
            |||..|...|||.....|:.               |.|...|...|..:  .|.:...|.|.:|:
Mouse    78 VEGNGTGRKLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLI--LGPVCEYAAAPVAR 140

  Fly   773 L-THLTKILLLLSIAALHCYFNIFIMQDLYALEDDFEHQPIISTRYAASGLLLVAALALSTLARH 836
            | :|..  |.:||..||...|.        ..:.::.|...::..||..|.:::|      |.||
Mouse   141 LASHWD--LPMLSAGALAAGFQ--------HKDTEYSHLTRVAPAYAKMGEMMLA------LFRH 189

  Fly   837 MDHEDRVIFKWKTEVAEQKETANDMRQRN-----EAL--VYNVLPVHVAEHFMKNTK-RSHDDL- 892
             .|..|....:          ::|..:||     |.:  |:....:|.:.:....|| ...||: 
Mouse   190 -HHWSRAALVY----------SDDKLERNCYFTLEGVHEVFQEEGLHTSAYNFDETKDLDLDDIV 243

  Fly   893 -YSQSYAEVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIG 956
             |.|....|.::.|         |.:|:....|...|  :.:.|...|...:..|.        .
Mouse   244 RYIQGSERVVIMCA---------SGDTIRRIMLAVHR--HGMTSGDYAFFNIELFN--------S 289

  Fly   957 STYMAASGINVQRTVRNDAPITERWSHLAILV----------EFALELKHAL--QSINEQSF-NH 1008
            |:|...|.   :|..::|:...:.:|.|..:.          :|::|:|.::  |.:||:.: |.
Mouse   290 SSYGDGSW---RRGDKHDSEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNEEDYVNM 351

  Fly  1009 FV--------LKMGINHGPITAGVIGARKPHYDI----WGNT-------VNVASRMESTGKAGAI 1054
            ||        |.:...|..:.||.  ::|....|    |..|       |::.:..:..|....:
Mouse   352 FVEGFHDAILLYVLALHEVLRAGY--SKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVV 414

  Fly  1055 QVTEETCNILRLFGYTFLQRGLVAVKGKGQLMTFYLQGKSQSSAEPVASGVVVLNGQDSSAVEST 1119
            .:|:.......:.|..|.:.|...::...:    |..|..:...:...    ::...:||..:|:
Mouse   415 AMTDTEAGTQEVIGDYFGKEGRFQMRSNVK----YPWGPLKLRLDETR----IVEHTNSSPCKSS 471

  Fly  1120 SELEASDI------------------------KMPLLKMNGPEQSLEIDQDRSLRNDS 1153
            ..||.|.:                        ::.:.:.|..|:| .|.:.|.||.||
Mouse   472 GGLEESAVTGIVVGALLGAGLLMAFYFFRKKYRITIERRNQQEES-NIGKHRELREDS 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 49/252 (19%)
Guanylate_cyc 892..1092 CDD:278633 42/233 (18%)
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 85/414 (21%)
ANF_receptor 66..419 CDD:279440 82/393 (21%)
TM_EphA1 471..502 CDD:214014 3/30 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.