DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and gcy-32

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_506452.5 Gene:gcy-32 / 179887 WormBaseID:WBGene00001552 Length:684 Species:Caenorhabditis elegans


Alignment Length:378 Identity:94/378 - (24%)
Similarity:171/378 - (45%) Gaps:66/378 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 YVTLPLQLIFLGLSIGCITYFICLSLPVGYSHWDSLLSNQLAANAVLIATAALIGLLYYFMGEAK 238
            |||...:|:..|:.:        .::|:..:..|.:|.||...:.|.:..               
 Worm   360 YVTSINELMQYGMRL--------TAMPLHDATRDLILLNQQRLSDVEVNL--------------- 401

  Fly   239 QKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAFKKIYMSRHENVS 303
            |..|..|..:::..::.:|.|..:.  :|..:||:.:|.::   |.....||      ..|| .:
 Worm   402 QLEANNEQLETMTRELELERQKTDS--ILKDMLPRRIAQQL---LSGEHIEA------CEHE-AT 454

  Fly   304 ILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCISGAPDERPDHA 368
            :::.|:..|.......|.:|:|.||||:|.:.||:.......:::.:.|.|..:||.||..|:||
 Worm   455 VMFCDLPAFQQAIPQCSPKDIVNMLNEIFRKLDRIVVIRGVYKVETVSDSYMAVSGIPDYTPEHA 519

  Fly   369 VLCVHMGLSMV-KAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELANKMESS 432
            ....|:.|.|: :|...:...:.:|..:|:|||:|.:.||::|....::.::.:.|.||::|||.
 Worm   520 ENMCHVALGMMWEARSVIDPVSKTPFLLRIGIHSGTITAGVVGTVHPKYCLFGETVTLASQMESL 584

  Fly   433 GKAGRVHISDKTL--AFLNGEFEVEAAFGEKREELLRIAGL-KTYFITKVVKAFASPCAKKINET 494
            |.||::..|....  |...|.||    |..:....::..|| :|||:|:.:|       |.|.|.
 Worm   585 GMAGKIQCSKWAYQKAMETGRFE----FSPRGRIDVKQRGLTETYFLTRSLK-------KSIWEI 638

  Fly   495 QAEIAHPNPNGSTTDIVSDEDDNDATLDDEELLAQNSVSNGHQIGIAVTADEE 547
               |.|            |.|.|..:::..|.| :.::.|...|..|:...::
 Worm   639 ---IDH------------DRDINVNSIEGYEEL-ETAIENAVTIKSALPRPDQ 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831 21/110 (19%)
CYCc 256..453 CDD:214485 57/199 (29%)
Guanylate_cyc 294..476 CDD:278633 55/185 (30%)
CYCc 860..1071 CDD:214485
Guanylate_cyc 892..1092 CDD:278633
gcy-32NP_506452.5 HNOB 3..167 CDD:285002
HNOBA 226..440 CDD:285003 20/104 (19%)
CYCc 419..608 CDD:214485 59/204 (29%)
Guanylate_cyc 452..627 CDD:278633 54/179 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.