DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and gcy-7

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_001360539.1 Gene:gcy-7 / 179222 WormBaseID:WBGene00001534 Length:1117 Species:Caenorhabditis elegans


Alignment Length:296 Identity:82/296 - (27%)
Similarity:156/296 - (52%) Gaps:37/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSS-SSEAFKKIYMSRHENVSILYA 307
            ||.:.|...|.::||:. :.:.||..:|||.||.|::  ||.: ..|.|        |.|:|.::
 Worm   847 LEEEVSERTKELVEEKK-KSDVLLYRMLPKTVADKLK--LGQTVEPETF--------EQVTIFFS 900

  Fly   308 DIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCISGAPDER-PDHAVLC 371
            |:|.||.::|..:...:|.:||:|:..||.:.||:...:::.:||.|.|:||.|... .:|....
 Worm   901 DVVQFTTLASKCTPLQVVNLLNDLYTIFDGIIEKHDVYKVETIGDGYLCVSGLPHRNGNEHVRQI 965

  Fly   372 VHMGLSMVKAIKY--VQQKANSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELANKMESSGK 434
            ..|.|:.:.::::  |....:..:::|:|::.|:|:||::|....:|.::...|..|::|||:||
 Worm   966 ALMSLAFLSSLQFFRVPHLPSERINLRIGMNCGSVVAGVVGLTMPRFCLFGDAVNTASRMESNGK 1030

  Fly   435 AGRVHISDKT--LAFLNGEFEVEAAFGEKREELLRIAG-LKTYFI----TKVVKAFASPCAKKIN 492
            .|::|:|.:.  :..|.|.|:.|:    :.|.:::..| ::|:::    |..|.......|||::
 Worm  1031 PGKIHVSAEANRMLHLVGGFDTES----RGEVIIKGKGVMETFWLTGQGTGAVSGARHVSAKKVS 1091

  Fly   493 ETQAEIAHPNPNGSTTDIVSDEDDNDATLDDEELLA 528
            :...|           :...||.....||..:|.|:
 Worm  1092 KKMYE-----------EFQMDEIHRQETLKSDEQLS 1116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831 15/40 (38%)
CYCc 256..453 CDD:214485 61/202 (30%)
Guanylate_cyc 294..476 CDD:278633 52/187 (28%)
CYCc 860..1071 CDD:214485
Guanylate_cyc 892..1092 CDD:278633
gcy-7NP_001360539.1 PBP1_NPR_GC-like 36..438 CDD:380575
PKc_like 550..822 CDD:389743
CYCc 860..1049 CDD:214485 60/199 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.