DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and gcy-28

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_001021600.1 Gene:gcy-28 / 172051 WormBaseID:WBGene00020131 Length:1276 Species:Caenorhabditis elegans


Alignment Length:212 Identity:60/212 - (28%)
Similarity:122/212 - (57%) Gaps:20/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 VIEEQSAEQ-------ERLLLSVLPKHVAIKMREDLGSSSSEAFKKIYMSRHENVSILYADIVGF 312
            ::||::.|.       |.||..:||..:|         .:..|.:.:....::.|:|.::|||||
 Worm  1040 LVEERTQEYLAEKKKVEELLHQLLPPAIA---------DTLIAGRAVQAESYDCVTIYFSDIVGF 1095

  Fly   313 TAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCISGAPDERPDHAVLCVHMGLS 377
            |::||..:...:|.:||:|:..||.:.:.::..:::.:||.|..:||.|:.|.|||.....|.||
 Worm  1096 TSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDDHANQIAQMSLS 1160

  Fly   378 MVKAIK--YVQQKANSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELANKMESSGKAGRVHI 440
            ::..:|  .::.:.:..:.:|:|:|:|:|:||::|.:..::.::...|..:::|||:|...::|:
 Worm  1161 LLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHV 1225

  Fly   441 SDKTLAFLNGE--FEVE 455
            |.:|...|..|  |::|
 Worm  1226 SQQTYDILMQEAGFKLE 1242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831 9/36 (25%)
CYCc 256..453 CDD:214485 58/207 (28%)
Guanylate_cyc 294..476 CDD:278633 50/166 (30%)
CYCc 860..1071 CDD:214485
Guanylate_cyc 892..1092 CDD:278633
gcy-28NP_001021600.1 PBP1_NPR_like 42..486 CDD:107368
ANF_receptor 64..465 CDD:279440
PK_GC-A_B 722..1016 CDD:270944
STYKc 741..1008 CDD:214568
HNOBA <1026..1071 CDD:285003 9/39 (23%)
CYCc 1050..1233 CDD:214485 53/191 (28%)
Guanylate_cyc 1077..1262 CDD:278633 50/166 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.