DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and Gucy2c

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_001120790.1 Gene:Gucy2c / 14917 MGIID:106903 Length:1072 Species:Mus musculus


Alignment Length:365 Identity:98/365 - (26%)
Similarity:158/365 - (43%) Gaps:78/365 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   799 DLYAL-----EDDFEHQP----IISTRYAASGLL-----------LVAALALSTLARHMDHEDRV 843
            ::|.|     |:|.|.:|    |.||.....||.           |:..|.|  .:|:::|    
Mouse   718 EVYLLVKSCWEEDPEKRPDFKKIESTLAKIFGLFHDQKNESYMDTLIRRLQL--YSRNLEH---- 776

  Fly   844 IFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMP 908
                  .|.|:.:.....|.|.:.|.:.:||..|    :|:.|.. ..:..:.|.||.:.|:.:.
Mouse   777 ------LVEERTQLYKAERDRADHLNFMLLPRLV----VKSLKEK-GIVEPELYEEVTIYFSDIV 830

  Fly   909 NFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGINVQRTVRN 973
            .|:......|    .:|.:..||::...||.:::   ..|:.|::|||..|:.|||:        
Mouse   831 GFTTICKYST----PMEVVDMLNDIYKSFDQIVD---HHDVYKVETIGDAYVVASGL-------- 880

  Fly   974 DAPITERWSHLAILVEFALELKHALQSINEQSFNHFV-----LKMGINHGPITAGVIGARKPHYD 1033
              |:.....|...:.:.||::   |..|......|..     :::|::.||..|||:|.:.|.|.
Mouse   881 --PMRNGNRHAVDISKMALDI---LSFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYC 940

  Fly  1034 IWGNTVNVASRMESTGKAGAIQVTEETCNILRLFGYTFLQ--RGLVAVKGKGQLMTFYLQG-KSQ 1095
            ::|:|||.||||||||....|.::..|..||:.....||.  ||...:||:|...|::|.| |.|
Mouse   941 LFGDTVNTASRMESTGLPLRIHMSSSTITILKRTDCQFLYEVRGETYLKGRGTETTYWLTGMKDQ 1005

  Fly  1096 SSAEPVASGVVVLNGQDSSAVESTSEL--EASDIKMPLLK 1133
            .           .|......||:...|  |.||:.:..|:
Mouse  1006 E-----------YNLPSPPTVENQQRLQTEFSDMIVSALQ 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 60/215 (28%)
Guanylate_cyc 892..1092 CDD:278633 61/206 (30%)
Gucy2cNP_001120790.1 Periplasmic_Binding_Protein_Type_1 35..415 CDD:299141
PKc_like 480..749 CDD:304357 9/30 (30%)
STYKc 502..744 CDD:214568 8/25 (32%)
CYCc 787..978 CDD:214485 60/215 (28%)
Guanylate_cyc 814..1001 CDD:278633 61/206 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.