DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and gc2

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:XP_021333059.1 Gene:gc2 / 140425 ZFINID:ZDB-GENE-011128-8 Length:1120 Species:Danio rerio


Alignment Length:290 Identity:81/290 - (27%)
Similarity:133/290 - (45%) Gaps:44/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   851 VAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFYS 915
            :.|:.|.....:|:.|.|:..:||..|||.....|     .:..:.:..|.:.|:.:..|:..  
Zfish   839 IRERTEELEIEKQKTEKLLTQMLPPSVAEALKLGT-----TVEPEHFESVSLYFSDIVGFTTI-- 896

  Fly   916 EETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGINVQRTVRNDAPITER 980
              :.|::.:|.:..||::.:.|||::   ...|:.|::|||..||.|||:          |:...
Zfish   897 --SANSEPIEVVDLLNDLYTTFDAVI---GNHDVYKVETIGDAYMVASGV----------PVPNG 946

  Fly   981 WSHLAILVEFALELKHALQSINEQSFNHFV-----LKMGINHGPITAGVIGARKPHYDIWGNTVN 1040
            ..|.|.:...||::   |.::......|..     :::|::.||..|||:|...|.|.::|:||.
Zfish   947 NRHAAEIANMALDI---LSAVGTFRMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVT 1008

  Fly  1041 VASRMESTGKAGAIQVTEETCNILR--LFGYTFLQRGLVAVKGKGQLMTFYLQGKSQSSAEPVAS 1103
            .||||||||....|.|...|..||.  ..||....|....:|||....|::|.|: ....:|:..
Zfish  1009 TASRMESTGLPYRIHVHSSTVKILMELKLGYRVELRARTELKGKRIEETYWLTGR-DGFTKPLPV 1072

  Fly  1104 GVVVLNGQDSSAVESTSELEASDIKMPLLK 1133
            ..|:.:|           ||:.|.|:.|.|
Zfish  1073 PPVLKSG-----------LESKDFKVMLKK 1091

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 63/217 (29%)
Guanylate_cyc 892..1092 CDD:278633 60/206 (29%)
gc2XP_021333059.1 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..815 CDD:270945
HNOBA <824..869 CDD:311573 10/29 (34%)
CYCc 848..1040 CDD:214485 62/216 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.