DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and Gucy2e

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_570093.2 Gene:Gucy2e / 113911 RGDID:69322 Length:1123 Species:Rattus norvegicus


Alignment Length:297 Identity:87/297 - (29%)
Similarity:130/297 - (43%) Gaps:70/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   851 VAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFSDFYS 915
            |.|:.|.....|::.|.|:..:||..|| |.:|.......:.:.|    |.:.|:.:..|:    
  Rat   848 VQERTEELELERRKTERLLSQMLPPSVA-HALKMGTTVEPEYFDQ----VTIYFSDIVGFT---- 903

  Fly   916 EETVN--NQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGINVQRTVRNDAPIT 978
              |::  ::.:|.:.|||::.:.|||:|:   ..|:.|::|||..||.|||:          |..
  Rat   904 --TISALSEPIEVVGFLNDLYTMFDAVLD---SHDVYKVETIGDAYMVASGL----------PRR 953

  Fly   979 ERWSHLAILVEFALELKHALQSINEQSFNH-----FVLKMGINHGPITAGVIGARKPHYDIWGNT 1038
            ....|.|.:...|||:   |.........|     ..::.|::.||..|||:|...|.|.::|:|
  Rat   954 NGNRHAAEIANMALEI---LSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDT 1015

  Fly  1039 VNVASRMESTGKAGAIQVTEETCNILRLF--GYTFLQRGLVAVKGKGQLMTFYLQGKS------- 1094
            ||.||||||||....|.|:..|...|...  ||....||...:||||...|::|.||:       
  Rat  1016 VNTASRMESTGLPYRIHVSRNTVQALLSLDEGYKIDVRGQTELKGKGLEETYWLTGKTGFCRSLP 1080

  Fly  1095 ---------------------------QSSAEPVASG 1104
                                       ||.|||.:||
  Rat  1081 TPLSIQPGDPWQDHINQEIRTGFAKARQSLAEPRSSG 1117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 67/219 (31%)
Guanylate_cyc 892..1092 CDD:278633 66/208 (32%)
Gucy2eNP_570093.2 PBP1_sensory_GC_DEF-like 71..445 CDD:380594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 529..556
PK_GC-2D 554..824 CDD:270945
CYCc 861..1050 CDD:214485 66/215 (31%)
Interaction with NCALD. /evidence=ECO:0000269|PubMed:18178149 880..921 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.