DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and gucy1b1

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:724 Identity:156/724 - (21%)
Similarity:268/724 - (37%) Gaps:210/724 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 EFEVEAAFGEKREELLRIA--GLKTYFI----TKVVKAFASP------------CAKKINETQAE 497
            :.:.||...|:.:.|:||.  ..|||.:    |||:...|..            |.:...:|...
 Frog    24 DIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILR 88

  Fly   498 IAHPNPNGSTTDIVSDEDD---------------NDATLDDEELLAQNSVSNGHQ---IGIAVTA 544
            :...|......::.:..|.               .||......:|...|...|.|   |||..|.
 Frog    89 VLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTV 153

  Fly   545 DEE---EQVKLENFKQR---------LKDELVTRDGHENLTKDTNIFLRF-KNPQLEQLYAVY-- 594
            .::   .::.::..:||         |.:|..||:  |:..:|.:   || :|...|...:.|  
 Frog   154 AQQIHGTEIDMKVIQQRNEECDHTQFLIEEKDTRE--EDFYEDQD---RFEENGTQESRISPYTF 213

  Fly   595 --REPYSSLPLLAALLVQCIDVLYSYLVLPR------STLHFINIAAPLVPIAMLVVISLAESFS 651
              ..|:..:......:.||.:.:|.  |||:      :.|...::..|.:.|          ||.
 Frog   214 CKAFPFHIMFDRDLFVTQCGNAIYR--VLPQLQPGNCNLLSVFSLVRPHIDI----------SFH 266

  Fly   652 GMLPKFFVDVSKRFNDITFVRELAAIIIALTIGFSNVIDMFFFVTFVRTEHIVSESEFNVTASLE 716
            |:|        ...|.:..:|....::                      :...||||..:|.:..
 Frog   267 GIL--------SHINTVFVLRSKEGLL----------------------DVEKSESEDELTGTEI 301

  Fly   717 SDINLVVEGMVTAEHLLPASFVEQMRDAVPTERVLYPSYLSNFGVLILIAIAVIAQLTHLTKILL 781
            |.:.|  :|.:.                          ||.....::.:....:..|..||:..|
 Frog   302 SCLRL--KGQMI--------------------------YLPEADNILFLCSPSVMNLDDLTRRGL 338

  Fly   782 LLSIAALHCYFNIFIMQDLYALEDDFEHQPIISTRYAASGLLLVAALALSTLARHMDHEDRVIFK 846
            .||...||     ...:||..|.:.|..:..::..             |..|...:.|..|.:  
 Frog   339 YLSDIPLH-----DATRDLVLLGEQFREEYKLTQE-------------LEILTDRLQHTLRAL-- 383

  Fly   847 WKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYAEVGVLFASMPNFS 911
                        .|.:::.:.|:|:|||..||     |..|....:.::.|..|.:||:.:..|:
 Frog   384 ------------EDEKKKTDTLLYSVLPPSVA-----NELRHKRPVPAKRYDNVTILFSGIVGFN 431

  Fly   912 DFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGSTYMAASGINVQRTVRNDAP 976
            .|.|:.......::.:..||::.:.||.|.:......:.|::|:|..||..||| .:..|.:...
 Frog   432 TFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGI-PEPCVHHARS 495

  Fly   977 ITERWSHLAI-LVEFALELKHALQSINEQSFNHFVLKMGINHGPITAGVIGARKPHYDIWGNTVN 1040
            |    .|||: ::|.|.:::...:|:.        :.:||:.|.:..||||.|.|.|.::|||||
 Frog   496 I----CHLALDMMEIAGQVQVDGESVQ--------ITIGIHTGEVVTGVIGQRMPRYCLFGNTVN 548

  Fly  1041 VASRMESTGKAGAIQVTEETCNILRLFGYTF--------------LQ-RGLVAVKGKGQLMTFYL 1090
            :.||.|:||:.|.|.|:|          ||:              || ||.|::|||...|..:.
 Frog   549 LTSRTETTGEKGKINVSE----------YTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWF 603

  Fly  1091 QGKSQSSAE 1099
            ..:..:..|
 Frog   604 LSRKAAETE 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485 0/1 (0%)
Guanylate_cyc 294..476 CDD:278633 9/26 (35%)
CYCc 860..1071 CDD:214485 63/211 (30%)
Guanylate_cyc 892..1092 CDD:278633 63/215 (29%)
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902 27/141 (19%)
HNOBA 207..406 CDD:369471 52/305 (17%)
Guanylate_cyc 412..605 CDD:306677 63/215 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.