DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and gucy1a2

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:XP_009290254.2 Gene:gucy1a2 / 100330875 ZFINID:ZDB-GENE-121023-3 Length:608 Species:Danio rerio


Alignment Length:322 Identity:86/322 - (26%)
Similarity:149/322 - (46%) Gaps:60/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LVYVTLP--LQLIFLGLSIGCITYFICLSLPVGYSHWDSL--------LSNQL----AANAVLIA 222
            ||...:|  .|.|.|.||    |.|...:.|.|    .||        |..|:    .:|:::..
Zfish   241 LVSPRIPCSFQNILLRLS----TPFTIRTRPDG----SSLDCREKVMELKGQMLHLPESNSIMFL 297

  Fly   223 TAALIGLLYYFMGE-------------------AKQKRAFLEAKKSLE-VKMVIEE--QSAEQER 265
            .:..:..|...||.                   .:|.:|....||.:: :|..:|:  |:.|:|:
Zfish   298 GSPRVDRLEELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLEKTHQALEEEK 362

  Fly   266 -----LLLSVLPKHVAIKMREDLGSSSSEAFKKIYMSRHENVSILYADIVGFTAISSTYSAQDLV 325
                 ||.|:.|..||.::.:.|         .:...:.::|::|::|||||||:.:..:...::
Zfish   363 RRTVDLLYSIFPGDVAQRLWQGL---------PVQAKKFDDVTMLFSDIVGFTAVCAQCTPMQVI 418

  Fly   326 KMLNELFARFDRLAEKYQQLRIKILGDCYYCISGAPDERPD-HAVLCVHMGLSMVKAIKYVQQKA 389
            .|||||:.|||.........:|:.:||. ||::|....:.| ||.....|.|.|::..:.|....
Zfish   419 SMLNELYTRFDYQCGILDVYKIETIGDA-YCVAGGLHRKIDSHAKPIALMALKMMELSEEVLTPD 482

  Fly   390 NSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNGE 451
            ..|:.:|:|||:|:||||::|....::.::..:|.||:|.||......:::|..|...|..:
Zfish   483 GKPIKLRIGIHSGSVLAGVVGVMMPRYCLFGNNVTLASKFESGSHPRCINVSPTTYQLLRDD 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831 36/153 (24%)
CYCc 256..453 CDD:214485 61/204 (30%)
Guanylate_cyc 294..476 CDD:278633 50/159 (31%)
CYCc 860..1071 CDD:214485
Guanylate_cyc 892..1092 CDD:278633
gucy1a2XP_009290254.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.