DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac3 and gucy1a2

DIOPT Version :9

Sequence 1:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster
Sequence 2:NP_001120379.1 Gene:gucy1a2 / 100145454 XenbaseID:XB-GENE-1011801 Length:712 Species:Xenopus tropicalis


Alignment Length:414 Identity:109/414 - (26%)
Similarity:181/414 - (43%) Gaps:88/414 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RFHQILLIIVPR-------ALWLLSILHFTVYVILQ----PSFSPRDLLGWAILLNFLVYVTLPL 179
            :||....|:.|:       .|..||    |.:||..    |:|..:|.:  ..:...::||....
 Frog   339 QFHDSFEIVSPKISCTFEQVLLRLS----TPFVIRNKPDAPTFENKDKV--MEVKGQMIYVPESS 397

  Fly   180 QLIFLGLSIGCITYFICLSLPVGYSHWDSLLSNQLAANAVLI--ATAALIGLLYYFMGEAKQKRA 242
            .::|||              .......|.|:...|..:.:.|  ||..:|     .:||  |.:|
 Frog   398 SILFLG--------------SPRVDKLDELMGRGLHLSDIPIHDATRDVI-----LVGE--QAKA 441

  Fly   243 FLEAKKSLE-VKMVIEE--QSAEQER-----LLLSVLPKHVAIKMREDLGSSSSEAFKKIYMSRH 299
            ....||.:: :|..:|:  |:.|:|:     ||.|:.|..||.::.|.         |.:...:.
 Frog   442 QDGLKKRMDKLKATLEKTHQALEEEKKKTVDLLYSIFPGDVAQQLWEG---------KSVQARKF 497

  Fly   300 ENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCYYCISGAPDER 364
            ::|::|::|||||||:.:..:...::.|||||:.|||.........:::.:||.|...:|...:.
 Frog   498 DDVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGFLDIYKVETIGDAYCVAAGLLRQS 562

  Fly   365 PDHAVLCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELANKM 429
            ..||.....|.|.|::..:.|......|:.||:|||:|:||||::|.|..::.::..:|.||:|.
 Frog   563 NSHAKPIALMALKMMELSEEVLTPDGRPIKMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKF 627

  Fly   430 ESSGKAGRVHISDKTLAFLNGEFEVEAAF---GEKREEL-----LRIAGLKTYFITKVVKAFASP 486
            ||.....|:::|..|...|..    ||.|   ...||||     ..|.|: .||:          
 Frog   628 ESGSHPRRINVSPTTYQLLKD----EANFHFVPRSREELPDNFPKEIPGI-CYFL---------- 677

  Fly   487 CAKKINETQAEIAHPNPNGSTTDI 510
                    :|:.....|..|.|.:
 Frog   678 --------EADSGQKQPKPSLTSV 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac3NP_610116.2 AC_N <127..285 CDD:292831 43/178 (24%)
CYCc 256..453 CDD:214485 62/203 (31%)
Guanylate_cyc 294..476 CDD:278633 60/189 (32%)
CYCc 860..1071 CDD:214485
Guanylate_cyc 892..1092 CDD:278633
gucy1a2NP_001120379.1 Pap_E4 30..>86 CDD:367150
HNOB <132..248 CDD:377902
HNOBA 296..486 CDD:369471 42/173 (24%)
Guanylate_cyc 492..679 CDD:306677 61/209 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.