DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2201 and CK1

DIOPT Version :9

Sequence 1:NP_001033932.2 Gene:CG2201 / 35417 FlyBaseID:FBgn0032955 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_177315.1 Gene:CK1 / 843500 AraportID:AT1G71697 Length:346 Species:Arabidopsis thaliana


Alignment Length:369 Identity:93/369 - (25%)
Similarity:144/369 - (39%) Gaps:111/369 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 REVLLRIYGQ------THGDHALESMITESVVFALLSERNYGPKLHGIFPGGRIEQYIPARALTT 245
            |:||:||||.      ..||        |...|..:|...|||||.|.|..||:|::|.||.|:.
plant    68 RKVLVRIYGDGVDLFFNRGD--------EIKTFECMSHHGYGPKLLGRFSDGRLEEFIHARTLSA 124

  Fly   246 AELGEQRILKRVAEKMGEIHSLNIPMSKEPDWIWNCMQRWVSGLESIVNGSVQTNQKSSVLKKQM 310
            .:|........:|.|:.|.|.|::|..|.. .:|..::.|:...:::.:            ..:|
plant   125 DDLRVAETSDFIAAKLREFHKLDMPGPKNV-LLWERLRTWLKEAKNLAS------------PIEM 176

  Fly   311 ELMRTFDYVQEMAWIRSIIDEGDYPVVFCHNDLQEGNILMRQPSAGQNERTPRESISSLRSNFDE 375
            :..|......|:..:...:...|..:.|||||||.||:::                       ||
plant   177 DKYRLEGLENEINLLEERLTRDDQEIGFCHNDLQYGNVMI-----------------------DE 218

  Fly   376 TLGDSLDGNSNISDTETHKSRSVSPSPCPELDTTNDSALDSSFMADNEPDLIIIDFEYCAYNYRG 440
                                            .||              .:.|||:||.::|...
plant   219 --------------------------------VTN--------------AITIIDYEYSSFNPIA 237

  Fly   441 YDLANHFIEWTFDY---TNPQFPYFYHNSSNCATVQQRRDFIVNYLKKFHDDENYNITG-QELMK 501
            ||:||||.|...:|   |.....|..:....     :||.||..||     ....|.|. :|:.:
plant   238 YDIANHFCEMAANYHSDTPHVLDYTLYPGEG-----ERRRFISTYL-----GSTGNATSDKEVER 292

  Fly   502 VDAEIQFFTMLSHLFWSLWSVIN-VTSAIEFGYWEYGIARILEY 544
            :..:.:.:|:.:|:||.||.:|: ..:.|||.|.||...|..:|
plant   293 LLKDAESYTLANHIFWGLWGIISGHVNKIEFDYMEYARQRFEQY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2201NP_001033932.2 ChoK_euk 159..549 CDD:270705 93/369 (25%)
CK1NP_177315.1 PLN02236 1..344 CDD:177880 93/369 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 110 1.000 Domainoid score I2103
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1469912at2759
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101889
Panther 1 1.100 - - O PTHR22603
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X906
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.