DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2201 and etnk2

DIOPT Version :9

Sequence 1:NP_001033932.2 Gene:CG2201 / 35417 FlyBaseID:FBgn0032955 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001029347.1 Gene:etnk2 / 555330 ZFINID:ZDB-GENE-050913-135 Length:360 Species:Danio rerio


Alignment Length:378 Identity:85/378 - (22%)
Similarity:157/378 - (41%) Gaps:107/378 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 VLLRIYGQ-----THGDHALESMITESVVFALLSERNYGPKLHGIFPGGRIEQYIPARALTTAEL 248
            ||:|:||.     ...|:.|:|       |.:|......|:|:..|..|...:::..|||.|.::
Zfish    72 VLVRVYGNKTELIVDRDNELKS-------FQVLHANGCAPRLYCTFQNGICYEFMQGRALDTQDV 129

  Fly   249 GEQRILKRVAEKMGEIHSLN-----IPMSKEPDWIWNCMQRWVSGLESIVNGSVQTNQKSSVLKK 308
            .:..:|:.:|.:|..||:::     ||   :|: :|..|:::.|.:      :.:..:::|.::.
Zfish   130 RDPVLLRLIAREMARIHAIHAHNGCIP---KPN-LWIKMRKYFSLV------ATEFTEQASNIRI 184

  Fly   309 QMELMRTFDYVQEMAWIRSIIDEGDYPVVFCHNDLQEGNILMRQPSAGQNERTPRESISSLRSNF 373
            |.|:.......|||.|::..:.:...|||.|||||...||:                        
Zfish   185 QQEVPSQEVLEQEMMWMKEHLSQLGSPVVLCHNDLLCKNII------------------------ 225

  Fly   374 DETLGDSLDGNSNISDTETHKSRSVSPSPCPELDTTNDSALDSSFMADNEPDLIIIDFEYCAYNY 438
                               |.::                          |..:..||:||.:|||
Zfish   226 -------------------HNAK--------------------------EGHVRFIDYEYSSYNY 245

  Fly   439 RGYDLANHFIEWTFDYTNPQFPYFYHNSSNCATVQQRRDFIVNYLK--KFHDDENYNITGQELMK 501
            :.:|:.|||.|:. ..:.|.:..:       .:.:.:.|::..||:  |....:..:::.:||..
Zfish   246 QAFDIGNHFNEFA-GMSEPDYNLY-------PSREMQLDWLQTYLQAYKLFTKKGEDVSERELET 302

  Fly   502 VDAEIQFFTMLSHLFWSLWSVINVT-SAIEFGYWEYGIARILEYQKLKAAYQA 553
            :..::..|.:.||.||..|::|... |.|||.:..|.:.|..:|.|.|.|..|
Zfish   303 LYVQVNKFALASHFFWGFWALIQAKYSTIEFDFLGYAVLRFNQYFKTKPAVMA 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2201NP_001033932.2 ChoK_euk 159..549 CDD:270705 82/372 (22%)
etnk2NP_001029347.1 ETNK_euk 46..348 CDD:270706 81/369 (22%)
APH 49..289 CDD:279908 65/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.