DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2201 and ETNK1

DIOPT Version :9

Sequence 1:NP_001033932.2 Gene:CG2201 / 35417 FlyBaseID:FBgn0032955 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_016875069.1 Gene:ETNK1 / 55500 HGNCID:24649 Length:425 Species:Homo sapiens


Alignment Length:443 Identity:92/443 - (20%)
Similarity:156/443 - (35%) Gaps:151/443 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 AAKAVGVTLMARELINNDDVADAAPG------ATQAHKRQRCDSNSRECSSSKRLH-APKQQPRE 188
            |...|.|:.:|..:.|...|...:|.      ..|..:..||    ||.:.|...| .|...|:|
Human    77 AVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRC----REGALSLLQHLRPHWDPQE 137

  Fly   189 VLLRIY-------------GQTHGDHALESMI---TESVV--------FALLSERNYGPKLHGIF 229
            |.|:::             |.|..|..|..:.   ||.:|        |.:|......|:|:..|
Human   138 VTLQLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTF 202

  Fly   230 PGGRIEQYIPARALTTAELGEQRILKRVAEKMGEIHSLN-----IPMSKEPDWIWNCMQRWVSGL 289
            ..|...::|...||....:....|.:.:|.::.:||:::     ||.|.    :|..|.::.|.:
Human   203 NNGLCYEFIQGEALDPKHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSN----LWLKMGKYFSLI 263

  Fly   290 ------ESIVNGSVQTNQKSSVLKKQMELMRTFDYVQEMAWIRSIIDEGDYPVVFCHNDLQEGNI 348
                  |.|....:.....|.:|:            :||.|::.|:.....|||.|||||...||
Human   264 PTGFADEDINKRFLSDIPSSQILQ------------EEMTWMKEILSNLGSPVVLCHNDLLCKNI 316

  Fly   349 LMRQPSAGQNERTPRESISSLRSNFDETLGDSLDGNSNISDTETHKSRSVSPSPCPELDTTNDSA 413
            :       .||:                                                     
Human   317 I-------YNEK----------------------------------------------------- 321

  Fly   414 LDSSFMADNEPDLIIIDFEYCAYNYRGYDLANHFIEWT----FDYTNPQFPYFYHNSSNCATVQQ 474
                     :.|:..||:||..|||..||:.|||.|:.    .||:      .|.:.      :.
Human   322 ---------QGDVQFIDYEYSGYNYLAYDIGNHFNEFAGVSDVDYS------LYPDR------EL 365

  Fly   475 RRDFIVNYLKKFHDDENYNITGQELMKVDAEIQFFTMLSHLFWSLWSVINVTS 527
            :..::..||:.:.:.:.:   |.|:.:.:.|| .|..::....:|.|..::|:
Human   366 QSQWLRAYLEAYKEFKGF---GTEVTEKEVEI-LFIQVNQFALTLQSAFSLTA 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2201NP_001033932.2 ChoK_euk 159..549 CDD:270705 85/409 (21%)
ETNK1XP_016875069.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.