DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2201 and ETNK2

DIOPT Version :9

Sequence 1:NP_001033932.2 Gene:CG2201 / 35417 FlyBaseID:FBgn0032955 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001284689.1 Gene:ETNK2 / 55224 HGNCID:25575 Length:394 Species:Homo sapiens


Alignment Length:307 Identity:69/307 - (22%)
Similarity:117/307 - (38%) Gaps:111/307 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 VLLRIYGQTHGDHALESMITESVV--------FALLSERNYGPKLHGIFPGGRIEQYIPARALTT 245
            ||:|:||:.          ||.:|        |.||...:..|||:..|..|...:|:...||..
Human   109 VLVRVYGER----------TELLVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEP 163

  Fly   246 AELGEQRILKRVAEKMGEIHSLNIPMSKEPDWIWNCMQRWVSGLESIVNGSVQTN-QKSSVLKKQ 309
            ..:.|.|:.:.:|.:|.:||:::...|.....:|:.|..:.:.:::.:|.|:..: .|..||:: 
Human   164 EHIREPRLFRLIALEMAKIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLER- 227

  Fly   310 MELMRTFDYVQEMAWIRSIIDEGDYPVVFCHNDLQEGNILMRQPSAGQNERTPRESISSLRSNFD 374
                       |:||::..:.:.:.|||||||||...||:.                        
Human   228 -----------ELAWLKEHLSQLESPVVFCHNDLLCKNIIY------------------------ 257

  Fly   375 ETLGDSLDGNSNISDTETHKSRSVSPSPCPELDTTNDSALDSSFMADNEPDLIIIDFEYCAYNYR 439
                ||:.|:                                         :..||:||..|||:
Human   258 ----DSIKGH-----------------------------------------VRFIDYEYAGYNYQ 277

  Fly   440 GYDLANHFIEWT----FDY-------TNPQFPYFYHNSSNCATVQQR 475
            .:|:.|||.|:.    .||       |..|:.::|..:.....|..|
Human   278 AFDIGNHFNEFAGVNEVDYCLYPARETQLQWLHYYLQAQKGMAVTPR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2201NP_001033932.2 ChoK_euk 159..549 CDD:270705 69/307 (22%)
ETNK2NP_001284689.1 ETNK_euk 83..338 CDD:270706 69/307 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.