DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2201 and Etnk2

DIOPT Version :9

Sequence 1:NP_001033932.2 Gene:CG2201 / 35417 FlyBaseID:FBgn0032955 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001101813.1 Gene:Etnk2 / 360843 RGDID:1305304 Length:163 Species:Rattus norvegicus


Alignment Length:219 Identity:40/219 - (18%)
Similarity:61/219 - (27%) Gaps:116/219 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EEIRHAAARICRDYLTGPWKVVTPESLVVKRISGGLSNFLY--YVSLPDLNDYDELDEQKQQQED 109
            ::|...|.|:.|: |...||   ||.:..||...|::|.|.  ||                 :||
  Rat    32 DDILPGALRLIRE-LRPHWK---PEQVRTKRFKDGITNKLLACYV-----------------EED 75

  Fly   110 IIGATATVTNRSGVFIHDDESAAKAVGVTLMARELINNDDVADAAPGATQAHKRQRCDSNSRECS 174
            :                                                            |:| 
  Rat    76 M------------------------------------------------------------RDC- 79

  Fly   175 SSKRLHAPKQQPREVLLRIYGQTHGDHALESMITESVV--------FALLSERNYGPKLHGIFPG 231
                          ||:|:||:.          ||.:|        |.||......|||:..|..
  Rat    80 --------------VLVRVYGEW----------TELLVDRENEIRNFQLLRAHGCAPKLYCTFQN 120

  Fly   232 GRIEQYIPARALTTAELGEQRILK 255
            |...:|:...||....:.|.::.:
  Rat   121 GLCYEYMQGVALGPEHIREPQLFR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2201NP_001033932.2 ChoK_euk 159..549 CDD:270705 22/105 (21%)
Etnk2NP_001101813.1 PKc_like 54..>144 CDD:304357 31/191 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.