DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2201 and Etnk1

DIOPT Version :9

Sequence 1:NP_001033932.2 Gene:CG2201 / 35417 FlyBaseID:FBgn0032955 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001101364.1 Gene:Etnk1 / 312828 RGDID:1308204 Length:363 Species:Rattus norvegicus


Alignment Length:428 Identity:96/428 - (22%)
Similarity:163/428 - (38%) Gaps:134/428 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 QAHKRQRCDSNSRECSSSKRLH-APKQQPREVLLRIY-------------GQTHGDHALESMI-- 207
            |..:.|||    |:.:.|...| .|...||||.|:::             |.|..|..|..:.  
  Rat    22 QDQEEQRC----RDGALSLLQHLRPHWDPREVTLQLFTDGITNKLIACYVGDTMDDVVLVRIYGN 82

  Fly   208 -TESVV--------FALLSERNYGPKLHGIFPGGRIEQYIPARALTTAELGEQRILKRVAEKMGE 263
             ||.:|        |.:|......|:|:..|..|...::|...||....:....|.:.:|.::.:
  Rat    83 KTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEFIQGEALDPQHVCNPAIFRLIARQLAK 147

  Fly   264 IHSLN-----IPMSKEPDWIWNCMQRWVSGLES-IVNGSVQTNQKSSVLKKQMELMRTFDYVQEM 322
            ||:::     ||.|.    :|..|.::.|.:.: ..:..:.....|.:...|:       ..:||
  Rat   148 IHAIHAHNGWIPKSN----LWLKMGKYFSLIPTGFADEDINKRFLSEIPSPQL-------LQEEM 201

  Fly   323 AWIRSIIDEGDYPVVFCHNDLQEGNILMRQPSAGQNERTPRESISSLRSNFDETLGDSLDGNSNI 387
            .|::.|:.....|||.|||||...||:       .||:                           
  Rat   202 TWMKEILSSLGSPVVLCHNDLLCKNII-------YNEK--------------------------- 232

  Fly   388 SDTETHKSRSVSPSPCPELDTTNDSALDSSFMADNEPDLIIIDFEYCAYNYRGYDLANHFIEWT- 451
                                               :.|:..||:||..|||..||:.|||.|:. 
  Rat   233 -----------------------------------QGDVQFIDYEYSGYNYLAYDIGNHFNEFAG 262

  Fly   452 ---FDYTNPQFPYFYHNSSNCATVQQRRDFIVNYLKKFHDDENY--NITGQELMKVDAEIQFFTM 511
               .||:      .|.:.      :.:..::.:||:.:.:.:.:  ::|.:|:..:..::..|.:
  Rat   263 VSDVDYS------LYPDR------ELQGQWLRSYLEAYKEYKGFGSDVTEKEVETLFIQVNQFAL 315

  Fly   512 LSHLFWSLWSVINVT-SAIEFGYWEYGIARILEYQKLK 548
            .||.||.||::|... |.|||.:..|.|.|..:|.|:|
  Rat   316 ASHFFWGLWALIQAKYSTIEFDFLGYAIVRFNQYFKMK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2201NP_001033932.2 ChoK_euk 159..549 CDD:270705 96/428 (22%)
Etnk1NP_001101364.1 ETNK_euk 49..351 CDD:270706 83/393 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.