DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lamp1 and LAMP5

DIOPT Version :9

Sequence 1:NP_610111.3 Gene:Lamp1 / 35411 FlyBaseID:FBgn0032949 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_036393.1 Gene:LAMP5 / 24141 HGNCID:16097 Length:280 Species:Homo sapiens


Alignment Length:218 Identity:47/218 - (21%)
Similarity:83/218 - (38%) Gaps:43/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 TSCIMLQMAAQLNFTYEAREGNFTTGLYNIPSNASVEDAECKSQ---TTQFIHLIW--------- 165
            |:|:|.:.||:....|:....|:...:......|....||.|.:   :...:.:.|         
Human    55 TTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKM 119

  Fly   166 -----------GPE-TSKQSLIMYFNKSNDTTVLSFMQIHLALLPEDFPDAKENQTVQLITRSDG 218
                       ||| |.:.|.:.:...|::.|              .|.||.........:....
Human   120 LFVKESHNMSKGPEATWRLSKVQFVYDSSEKT--------------HFKDAVSAGKHTANSHHLS 170

  Fly   219 AFKTPENMSYHCTRVQKINMTETLDAEQLIGWISVSHVQVEAFRRANDTGFSVGHDC---DSSET 280
            |..||...||.|...|.|::..: |.::.:..| :|.|.::.|...:|..||..|.|   :..:.
Human   171 ALVTPAGKSYECQAQQTISLASS-DPQKTVTMI-LSAVHIQPFDIISDFVFSEEHKCPVDEREQL 233

  Fly   281 SDVVPIAVGIALAALILVVLISY 303
            .:.:|:.:|:.|..:|:|.|..|
Human   234 EETLPLILGLILGLVIMVTLAIY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lamp1NP_610111.3 Lamp <77..318 CDD:279622 47/218 (22%)
LAMP5NP_036393.1 Lamp <40..229 CDD:307462 40/189 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11506
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.