DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lamp1 and CG43668

DIOPT Version :9

Sequence 1:NP_610111.3 Gene:Lamp1 / 35411 FlyBaseID:FBgn0032949 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001261110.1 Gene:CG43668 / 14462617 FlyBaseID:FBgn0263743 Length:180 Species:Drosophila melanogaster


Alignment Length:108 Identity:23/108 - (21%)
Similarity:40/108 - (37%) Gaps:26/108 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 STTIAPQPYP---QPSIGAWNTSCIMLQMAAQLNFTYEAREGNFTTGLYNIPSNASVEDAECKSQ 156
            :.|||.|.|.   .|.:.....|...:|:....:|.......|.|     |.:||:.::.:..|.
  Fly    14 ANTIAGQDYQVFGSPGVQVIYPSSSQVQVIGGRHFLRNGLRRNLT-----INANATSQNFQLISS 73

  Fly   157 TT----------QFIHLIWGPETSKQSLIMYFNKS----NDTT 185
            .:          .|:..::|    :|..|.|.|.:    ||.:
  Fly    74 LSNGNSGNTPLRNFLRSLFG----RQPNIQYVNLNSRAFNDVS 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lamp1NP_610111.3 Lamp <77..318 CDD:279622 23/108 (21%)
CG43668NP_001261110.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.