DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lamp1 and Cd68

DIOPT Version :9

Sequence 1:NP_610111.3 Gene:Lamp1 / 35411 FlyBaseID:FBgn0032949 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001277987.1 Gene:Cd68 / 12514 MGIID:88342 Length:326 Species:Mus musculus


Alignment Length:300 Identity:72/300 - (24%)
Similarity:125/300 - (41%) Gaps:55/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ANPLTS--------SSSTISTSS---TTTEKPITTRS--TSTITPRSTTPSTESPSTTAPVISTT 97
            |:|.||        .:.|:.|||   |.|..|.||.|  .:||:..:.:|:|...:|:..  |:|
Mouse    45 ASPTTSHRPTTTSHGNVTVHTSSGPTTVTHNPATTTSHGNATISHATVSPTTNGTATSPR--SST 107

  Fly    98 IAPQPYPQP------SIGA-----W---NTSCIMLQMAAQLNFTYEAREGNFTTGLYNIPSNASV 148
            :.|.|.|.|      |.||     |   :..|:.||...|:...|..:.|....|:..:..|.:.
Mouse   108 VGPHPGPPPPSPSPRSKGALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTK 172

  Fly   149 EDAECK------SQTTQFIHLIWGPETSKQSLIMYFNKSNDTTVLSFMQIHLALLPEDFPDAKEN 207
            ....|.      |.:..:..|.:|   .||.|    ::|..|..|.:|.:...:   .||.|.: 
Mouse   173 VQGGCDGTHPHLSLSFPYGQLTFG---FKQDL----HQSPSTVYLDYMAVEYNV---SFPQAAQ- 226

  Fly   208 QTVQLITRSDGAFKTPENMSYHCTRVQKINMTETLDAEQLIGWISVSHVQVEAFRRANDTGFSVG 272
            .|......|....:.|...|:.|... .|.::..:..:.|       .::::|.:..:...|...
Mouse   227 WTFMAQNSSLRELQAPLGQSFCCGNA-SIVLSPAVHLDLL-------SLRLQAAQLPDKGHFGPC 283

  Fly   273 HDCDSSETSDVVPIAVGIALAALILVVLISYLCARRRSTS 312
            ..|:..: |.::|:.:|:.|..|:.:|||::...|||.::
Mouse   284 FSCNRDQ-SLLLPLIIGLVLLGLLTLVLIAFCITRRRQST 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lamp1NP_610111.3 Lamp <77..318 CDD:279622 56/255 (22%)
Cd68NP_001277987.1 Lamp 36..326 CDD:279622 72/299 (24%)
Epiglycanin_TR 43..102 CDD:283334 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11506
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.