DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and PRSS27

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:269 Identity:102/269 - (37%)
Similarity:140/269 - (52%) Gaps:28/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVL 68
            |||...:..|.||:..|.|.:   ..|:|.|:|.....:|:|||:| ..||||||||||..:.||
Human    11 LLLCFGSQRAKAATACGRPRM---LNRMVGGQDTQEGEWPWQVSIQ-RNGSHFCGGSLIAEQWVL 71

  Fly    69 TAAHCMQSYAASEL-QVRVGSTSRSSGGE---VVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQ 129
            |||||.::.:.:.| ||.:|:......|.   ...||..:.:..|.......|||:::|.:||..
Human    72 TAAHCFRNTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPF 136

  Fly   130 TSKIRAIELADSEAV--SGTNAVVSGWGTTCFL-FCSSPDTLQKVEVDLLHYKDC----AADT-Y 186
            |:.|..:.|.|...:  :|.|..|:|||:.... ....|..|||:.|.::....|    :.|| :
Human   137 TNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEF 201

  Fly   187 NYGSDSILETMVCATGE--KKDACQGDSGGPLVADNKLV-------GVVSWGSGCAWTGYPGVYA 242
            .|...:|...|:||..|  |||||:||||||||.   ||       ||:|||.|||....||||.
Human   202 GYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVC---LVGQSWLQAGVISWGEGCARQNRPGVYI 263

  Fly   243 DVASLRSWI 251
            .|.:..:||
Human   264 RVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 92/241 (38%)
Tryp_SPc 31..254 CDD:238113 93/242 (38%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 92/241 (38%)
Tryp_SPc 36..275 CDD:238113 93/241 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.