DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and Prss8

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:268 Identity:94/268 - (35%)
Similarity:137/268 - (51%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLSVVALVALAASCHG--NPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSET 66
            ||.|.:......|||..  .|       ||..|.......:|:|||: |..|:|.|||||:.::.
Mouse    23 LLQSGIRADGTEASCGAVIQP-------RITGGGSAKPGQWPWQVSI-TYDGNHVCGGSLVSNKW 79

  Fly    67 VLTAAHCM-QSYAASELQVRVGS---TSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPV 127
            |::||||. :.::....:|::|:   .|.|:...|.||.....|..|..:....|:|:|:|||||
Mouse    80 VVSAAHCFPREHSREAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPV 144

  Fly   128 RQTSKIRAIEL--ADSEAVSGTNAVVSGWGTTC-FLFCSSPDTLQKVEVDLLHYKDCAADTYNYG 189
            ..:..||.|.|  |::...:|.:..|:|||... .:...:|..||::||.|:..:.|:. .||..
Mouse   145 TFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSC-LYNIN 208

  Fly   190 S-----DSILETMVCATGEK--KDACQGDSGGPLVADNK----LVGVVSWGSGCAWTGYPGVYAD 243
            :     .:|.:.|:||...|  ||||||||||||....:    |.|:||||..|.....||||..
Mouse   209 AVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGAPNRPGVYTL 273

  Fly   244 VASLRSWI 251
            .::..|||
Mouse   274 TSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 85/238 (36%)
Tryp_SPc 31..254 CDD:238113 86/239 (36%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 86/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.