DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:269 Identity:104/269 - (38%)
Similarity:145/269 - (53%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LSVVA--LVALAAS-CHGNPGLDFPFG-RIVNGEDVDIENYPYQVSVQT-TKGSHFCGGSLIDSE 65
            |:||.  ||.:|.| |..|.....|.. :||.|::....::|:|||:|: |.|.||||||||:.:
Zfish     7 LTVVGALLVNIAGSLCQLNVCGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKD 71

  Fly    66 TVLTAAHCMQSYAASELQVRVGSTSRSSGGE---VVTVRAFKYHEGYNSKLMINDVAIIKLSSPV 127
            .||:||||.|. :...:.|::|..|:|....   ..||.....|..||:....||:|::||.|.|
Zfish    72 WVLSAAHCFQD-SIGTIMVKLGLQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSV 135

  Fly   128 RQTSKIRAIEL--ADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGS 190
            .....|..:.|  |.:...:||.:.|:|||.........||.||:||:.::.:.||.. .|   .
Zfish   136 TFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKR-AY---P 196

  Fly   191 DSILETMVCA---TGEKKDACQGDSGGPLVADNK----LVGVVSWGSGCAWTGYPGVYADVASLR 248
            ..|...|:||   ....||:||||||||:|:.|.    ..|:||:|.|||..|||||||.|:..:
Zfish   197 GEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQ 261

  Fly   249 SWIVDTTDS 257
            .||..:|.|
Zfish   262 DWITSSTGS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 90/233 (39%)
Tryp_SPc 31..254 CDD:238113 92/235 (39%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 90/233 (39%)
Tryp_SPc 36..264 CDD:238113 90/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.