DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG17234

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:244 Identity:94/244 - (38%)
Similarity:128/244 - (52%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASEL-----QVRVGST 89
            ||:.||.:.||..|:|||:|.. |.|.||||:.....::|||||......:.|     |||.||.
  Fly    26 RIIGGEPIGIEQVPWQVSLQYF-GDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSA 89

  Fly    90 SRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGW 154
            ...|.|.:|.|.|...||.|...|.|||:||::||:|:..|||::.|.||.:.....:.|:||||
  Fly    90 LTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGW 154

  Fly   155 GTTCFLFCSS---PDTLQKVEVDLLHYKDCAADTYNYGSDSILE------TMVCATGEKKDACQG 210
            |.:..|..|:   |..||.:   .||.|            ||..      :::||....:.||.|
  Fly   155 GVSYILNDSTNLYPTHLQGL---ALHIK------------SIFSCRLFDPSLLCAGTYGRTACHG 204

  Fly   211 DSGGPLVADNKLVGVVSWG-SGCAWTGYPGVYADVASLRSWIVDTTDSL 258
            |||||||.:.:|||||||| .||..:.:   :..|...|.||::...|:
  Fly   205 DSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIASI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 91/235 (39%)
Tryp_SPc 31..254 CDD:238113 92/237 (39%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 91/235 (39%)
Tryp_SPc 27..243 CDD:238113 90/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443207
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.