DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and CG17239

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:229 Identity:94/229 - (41%)
Similarity:132/229 - (57%) Gaps:7/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTAAHCMQSYAASELQVRVGSTSRSSG 94
            |||.|:.:.|.:.|:|.|: ...|...||.::...:.|:|||||:.......|.|||||:....|
  Fly    23 RIVGGDLITILSVPWQASI-LRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFG 86

  Fly    95 GEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCF 159
            |:||.|.:...||.|:.. ..||:|:::|.|.:|..|.:..|.|||:...||:.|.|||||...|
  Fly    87 GQVVRVSSVLLHEEYDQS-WSNDIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGF 150

  Fly   160 LFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILETMVCATGEKKDACQGDSGGPLVADNKLVG 224
            . .:.|.::....||::....|..   :||. .|.:.|:||....||||.||||||||:.|||||
  Fly   151 K-KNYPMSILSASVDIVDQDQCRR---SYGR-KITKDMICAAAPGKDACSGDSGGPLVSGNKLVG 210

  Fly   225 VVSWGSGCAWTGYPGVYADVASLRSWIVDTTDSL 258
            :||:|..||...||||||:||.|:.||:...:.:
  Fly   211 IVSFGKECAHPEYPGVYANVAELKPWILGAIERI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 92/220 (42%)
Tryp_SPc 31..254 CDD:238113 93/222 (42%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 92/220 (42%)
Tryp_SPc 24..237 CDD:238113 91/219 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443210
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.