DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and PRTN3

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:269 Identity:76/269 - (28%)
Similarity:118/269 - (43%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQT--TKGSHFCGGSLIDSETV 67
            |.||:..:.|:.:...        ..||.|.:....:.||..|:|.  ..|||||||:||....|
Human    10 LASVLLALLLSGAARA--------AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFV 66

  Fly    68 LTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYH--------EGYNSKLMINDVAIIKLS 124
            ||||||::......:.|.:|:.:      |.|....:.|        ..|:::..:|||.:|:||
Human    67 LTAAHCLRDIPQRLVNVVLGAHN------VRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLS 125

  Fly   125 SPVRQTSKIRAIEL--ADSEAVSGTNAVVSGWGTTCFLFCSSP--DTLQKVEVDLLHYKDCAADT 185
            ||...::.:..::|  .|.....||..:..|||.   :....|  ..||::.|.::.:   ....
Human   126 SPANLSASVATVQLPQQDQPVPHGTQCLAMGWGR---VGAHDPPAQVLQELNVTVVTF---FCRP 184

  Fly   186 YNYGSDSILETMVCATGEKKDA--CQGDSGGPLVADNKLVGV---VSWGSGCAWTGYPGVYADVA 245
            :|          :|....::.|  |.|||||||:.|..:.|:   |.|  |||...:|..:..||
Human   185 HN----------ICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIW--GCATRLFPDFFTRVA 237

  Fly   246 SLRSWIVDT 254
            ....||..|
Human   238 LYVDWIRST 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 69/239 (29%)
Tryp_SPc 31..254 CDD:238113 71/241 (29%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.