DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17571 and PRSS2

DIOPT Version :9

Sequence 1:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:273 Identity:104/273 - (38%)
Similarity:142/273 - (52%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLLLSVVALVALAASCHGNPGLDFPF---GRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLI 62
            ||.||:......|:||          ||   .:||.|...:..:.|||||:.:  |.||||||||
Human     1 MNLLLILTFVAAAVAA----------PFDDDDKIVGGYICEENSVPYQVSLNS--GYHFCGGSLI 53

  Fly    63 DSETVLTAAHCMQSYAASEL----------QVRVGSTSRS--SGGEVVTVRAFKY--HEGYNSKL 113
            ..:.|::|.||.:|...|:|          |||:|..:..  .|.|.. :.|.|.  |..|||:.
Human    54 SEQWVVSAGHCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQF-INAAKIIRHPKYNSRT 117

  Fly   114 MINDVAIIKLSSPVRQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHY 178
            :.||:.:||||||....|::.||.|..:...:||.:::||||.|.......||.||.::..:|..
Human   118 LDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQ 182

  Fly   179 KDCAADTYNYGSDSILETMVCA--TGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVY 241
            .:|.|   :| ...|...|.|.  ....||:||||||||:|::.:|.|:||||.|||....||||
Human   183 AECEA---SY-PGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVY 243

  Fly   242 ADVASLRSWIVDT 254
            ..|.:...||.||
Human   244 TKVYNYVDWIKDT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 91/236 (39%)
Tryp_SPc 31..254 CDD:238113 93/238 (39%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 91/236 (39%)
Tryp_SPc 24..256 CDD:238113 93/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.